BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_B17 (928 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_35724| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_7309| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_1903| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_34414| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_38053| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) 55 7e-08 SB_54507| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_58426| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_57366| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_56245| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_55566| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_55077| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_53790| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_52894| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_51245| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_48533| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_47211| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_46066| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_45109| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_43715| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_42865| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_41269| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_40020| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_38531| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_35148| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_31008| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_30985| Best HMM Match : DUF1450 (HMM E-Value=1.5) 53 3e-07 SB_29391| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_24808| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_23019| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_21707| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_19542| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_19098| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_19031| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_17805| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_15695| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_12040| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_9760| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_5267| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_3766| Best HMM Match : Moricin (HMM E-Value=5.1) 53 3e-07 SB_1707| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_1382| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_1275| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_27738| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 5e-06 SB_58224| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_55737| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_54286| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_54219| Best HMM Match : Toxin_8 (HMM E-Value=8.1) 47 2e-05 SB_41217| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_38325| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_17471| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_16089| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_9623| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_59708| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_59685| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_59589| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_59479| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_58142| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_57899| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_57889| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_57793| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_57693| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_57320| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_55905| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_55790| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_55716| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_55631| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_55333| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_55090| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_54702| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_54683| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_54384| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_53884| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_53624| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_53241| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_52929| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_52402| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_51349| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_51271| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_50626| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_49587| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_49375| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_49357| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_49260| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_49181| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_48829| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_48601| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_48323| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_48037| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_47484| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_47382| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_47359| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_47312| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_46998| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_46785| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_46606| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_46553| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_46274| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_46222| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_46158| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_45670| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_45556| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_45238| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_44797| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_44462| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_43465| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_42828| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_42781| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_42533| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_42195| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_41845| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_40938| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_39214| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_38586| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_38311| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_37725| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_37267| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_37229| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_36145| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_35184| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_34961| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_34855| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_34644| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_34569| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_33632| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_33419| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_33059| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_32948| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_32667| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_32556| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_31680| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_31259| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_30530| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_30465| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_30185| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_29900| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_29015| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_28377| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_28369| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_28136| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_27976| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_27792| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_27734| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_26258| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_26165| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_25748| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_25006| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_24933| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_24744| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_24530| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_23602| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_23082| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_23076| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_22933| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_22408| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_22371| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_21708| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_21671| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_21133| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_21107| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_20737| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_20572| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_19574| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_19433| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_18666| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_17812| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_17809| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_17259| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_17176| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_16930| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_16732| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_16453| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_15769| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_15576| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_15019| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_14967| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_14861| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_14376| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_14280| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_14068| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_12970| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_12483| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_12400| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_11534| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_11286| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_11221| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_10946| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_10173| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_9717| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_9609| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_9186| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_9181| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_8946| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_8892| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_8840| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_8665| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_8650| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_8602| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_8412| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_8098| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_7942| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_7762| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_7701| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_6381| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_5634| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_5583| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_5352| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_4816| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_4803| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_4739| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_4616| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_4498| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_4379| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_3983| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_3821| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_3004| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_2988| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_2927| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_2917| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_2901| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_2472| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_2187| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_2000| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_1929| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_1735| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_1566| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_1545| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_1521| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_1469| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_1412| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_1338| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_1265| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_756| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_338| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_305| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_300| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_251| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_33| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_49591| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_1435| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_59645| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_59631| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_59194| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_58955| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_58947| Best HMM Match : Helicase_C (HMM E-Value=0.058) 38 0.009 SB_58783| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_58676| Best HMM Match : FUN14 (HMM E-Value=0.16) 38 0.009 SB_58639| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_58459| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_58410| Best HMM Match : Umbravirus_LDM (HMM E-Value=5.8) 38 0.009 SB_58084| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_57920| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_57210| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_56445| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_55949| Best HMM Match : FLYWCH (HMM E-Value=0.16) 38 0.009 SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_55180| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_55179| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_55096| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_54894| Best HMM Match : RuvB_C (HMM E-Value=2.3) 38 0.009 SB_54224| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_54223| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_53915| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_53615| Best HMM Match : GETHR (HMM E-Value=5.3e-09) 38 0.009 SB_53433| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_53012| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_52037| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_51499| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_50666| Best HMM Match : ig (HMM E-Value=2.8e-20) 38 0.009 SB_50584| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_50510| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_50269| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_50207| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_50037| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_49291| Best HMM Match : Herpes_UL69 (HMM E-Value=4.5) 38 0.009 SB_49138| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_48746| Best HMM Match : fn3 (HMM E-Value=7.2) 38 0.009 SB_48519| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_47856| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 38 0.009 SB_47451| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_47286| Best HMM Match : DUF485 (HMM E-Value=5.5) 38 0.009 SB_47049| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.69) 38 0.009 SB_45733| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069) 38 0.009 SB_45470| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 38 0.009 SB_45327| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_45312| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_44738| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_43936| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_42767| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) 38 0.009 SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_42593| Best HMM Match : Rho_GDI (HMM E-Value=3.7e-17) 38 0.009 SB_42360| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_42151| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_42061| Best HMM Match : CcoS (HMM E-Value=1.5) 38 0.009 SB_41957| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_41059| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_40873| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_40754| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) 38 0.009 SB_40612| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_40593| Best HMM Match : UCH (HMM E-Value=1.4e-07) 38 0.009 SB_40524| Best HMM Match : Ribosomal_S18 (HMM E-Value=2) 38 0.009 SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) 38 0.009 SB_39953| Best HMM Match : Ank (HMM E-Value=1.8e-19) 38 0.009 SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_39337| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_39248| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_38896| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_38748| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_38234| Best HMM Match : RuvB_C (HMM E-Value=7) 38 0.009 SB_38187| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_37089| Best HMM Match : Ribosomal_S9 (HMM E-Value=9.9) 38 0.009 SB_36515| Best HMM Match : UPF0126 (HMM E-Value=0.73) 38 0.009 SB_36183| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_35826| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_35652| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_35341| Best HMM Match : Acyl-CoA_dh_M (HMM E-Value=2.9e-14) 38 0.009 SB_35069| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_34721| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_34207| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_34127| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_34032| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-22) 38 0.009 SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) 38 0.009 SB_33167| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_33112| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_33062| Best HMM Match : DUF485 (HMM E-Value=7.5) 38 0.009 SB_32555| Best HMM Match : RVT_1 (HMM E-Value=2e-35) 38 0.009 SB_32231| Best HMM Match : PRKCSH (HMM E-Value=4.3e-12) 38 0.009 SB_32223| Best HMM Match : SH3BP5 (HMM E-Value=0.12) 38 0.009 SB_32080| Best HMM Match : Plasmid_stabil (HMM E-Value=5.7) 38 0.009 SB_31947| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_31888| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_31774| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_31147| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_31098| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_31001| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_30962| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_30926| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_30841| Best HMM Match : HLH (HMM E-Value=1.5) 38 0.009 SB_30603| Best HMM Match : PKD_channel (HMM E-Value=1.2e-15) 38 0.009 SB_30119| Best HMM Match : VWC (HMM E-Value=2.1) 38 0.009 SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_29430| Best HMM Match : AhpC-TSA (HMM E-Value=0.00012) 38 0.009 SB_29254| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_29238| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_28553| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_27679| Best HMM Match : zf-MYND (HMM E-Value=0.00039) 38 0.009 SB_27029| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_26979| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=0.017) 38 0.009 SB_26811| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_26519| Best HMM Match : DUF1242 (HMM E-Value=8.7) 38 0.009 SB_26370| Best HMM Match : Drf_FH1 (HMM E-Value=5.2) 38 0.009 SB_26141| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_25766| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_25318| Best HMM Match : fn3 (HMM E-Value=2e-15) 38 0.009 SB_24893| Best HMM Match : RuvB_C (HMM E-Value=3.6) 38 0.009 SB_24858| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_24766| Best HMM Match : Plasmid_stabil (HMM E-Value=7.3) 38 0.009 SB_24481| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_24446| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_24381| Best HMM Match : MMR_HSR1 (HMM E-Value=2) 38 0.009 SB_23906| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_23874| Best HMM Match : SSIII (HMM E-Value=5.4) 38 0.009 SB_23492| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_23451| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_23266| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_23148| Best HMM Match : DUF1491 (HMM E-Value=9.3) 38 0.009 SB_21952| Best HMM Match : Pertussis_S2S3 (HMM E-Value=3.2) 38 0.009 SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) 38 0.009 SB_21736| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_21178| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_20958| Best HMM Match : Peptidase_C15 (HMM E-Value=0.001) 38 0.009 SB_20773| Best HMM Match : DNA_pol_B_exo (HMM E-Value=2.5e-37) 38 0.009 SB_20654| Best HMM Match : Helicase_C (HMM E-Value=2.3e-21) 38 0.009 SB_20088| Best HMM Match : OAD_gamma (HMM E-Value=3) 38 0.009 SB_19974| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_19756| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_19194| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_19176| Best HMM Match : YGGT (HMM E-Value=1.1) 38 0.009 SB_19170| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_18680| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_18659| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_17152| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_16892| Best HMM Match : TIL (HMM E-Value=4.4) 38 0.009 SB_16821| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 38 0.009 SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_16558| Best HMM Match : SoxE (HMM E-Value=8.2) 38 0.009 SB_16131| Best HMM Match : RhoGEF (HMM E-Value=2e-05) 38 0.009 SB_15111| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_15016| Best HMM Match : Peptidase_C9 (HMM E-Value=7.2) 38 0.009 SB_15003| Best HMM Match : WAP (HMM E-Value=0.0036) 38 0.009 SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) 38 0.009 SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) 38 0.009 SB_12755| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_12438| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_12289| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_11969| Best HMM Match : Papilloma_E5 (HMM E-Value=4.6) 38 0.009 SB_11820| Best HMM Match : EGF_2 (HMM E-Value=9.8) 38 0.009 SB_11146| Best HMM Match : K_tetra (HMM E-Value=1.1e-34) 38 0.009 SB_10646| Best HMM Match : GPW_gp25 (HMM E-Value=5.8) 38 0.009 SB_10549| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_10448| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_10073| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_9649| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_9574| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_9532| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_9470| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_8947| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_8444| Best HMM Match : BRE (HMM E-Value=6.4) 38 0.009 SB_8427| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_8359| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_8298| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_7275| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_7053| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_6150| Best HMM Match : GAT (HMM E-Value=2.3e-34) 38 0.009 SB_5713| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_5443| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_5310| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_5128| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_4813| Best HMM Match : EMP24_GP25L (HMM E-Value=3.9e-13) 38 0.009 SB_4398| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) 38 0.009 SB_3825| Best HMM Match : Pheromone (HMM E-Value=3.3) 38 0.009 SB_3784| Best HMM Match : ICAM_N (HMM E-Value=4.1) 38 0.009 SB_3664| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_3614| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_3135| Best HMM Match : KorB_C (HMM E-Value=2.8) 38 0.009 SB_2945| Best HMM Match : NADH_dehy_S2_C (HMM E-Value=4.4) 38 0.009 SB_2451| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_2317| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_2218| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_1908| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 38 0.009 SB_1174| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_941| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_630| Best HMM Match : Pox_F17 (HMM E-Value=2.4) 38 0.009 SB_602| Best HMM Match : TSP_1 (HMM E-Value=1e-27) 38 0.009 SB_215| Best HMM Match : ALG3 (HMM E-Value=0.18) 38 0.009 SB_12| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_59622| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_59470| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_59436| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_59341| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_59321| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_59114| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_58497| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_58355| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_58133| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_58128| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_57986| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_57715| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_57590| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_57559| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_57358| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_57221| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_57198| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_56924| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_56846| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_56778| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_56683| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_56485| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_56072| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_55971| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_55894| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_55772| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_55573| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_55419| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_55386| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_55232| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_55215| Best HMM Match : Peptidase_A16_N (HMM E-Value=0.0003) 38 0.009 SB_55103| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_55047| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_54903| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_54851| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_54599| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_54482| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_54385| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6) 38 0.009 SB_54325| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_53938| Best HMM Match : Gln-synt_N (HMM E-Value=0.78) 38 0.009 SB_53936| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 >SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 60.5 bits (140), Expect = 2e-09 Identities = 26/31 (83%), Positives = 26/31 (83%) Frame = -1 Query: 925 WLXPVAIXRFXPGWTQDDSYRIRRSGRAEXG 833 WL PVAI R PGWTQDDSYRIRRSGRAE G Sbjct: 1 WLLPVAISRVLPGWTQDDSYRIRRSGRAERG 31 >SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 60.1 bits (139), Expect = 2e-09 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNPXKNXLSPLAXAT 927 PP QPDRCALSGNYRLESNP ++ LSPLA AT Sbjct: 12 PPVQPDRCALSGNYRLESNPVRHDLSPLAAAT 43 >SB_35724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 102 Score = 60.1 bits (139), Expect = 2e-09 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNPXKNXLSPLAXAT 927 PP QPDRCALSGNYRLESNP ++ LSPLA AT Sbjct: 12 PPVQPDRCALSGNYRLESNPVRHDLSPLAAAT 43 >SB_7309| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 60.1 bits (139), Expect = 2e-09 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNPXKNXLSPLAXAT 927 PP QPDRCALSGNYRLESNP ++ LSPLA AT Sbjct: 12 PPVQPDRCALSGNYRLESNPVRHDLSPLAAAT 43 >SB_1903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 60.1 bits (139), Expect = 2e-09 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNPXKNXLSPLAXAT 927 PP QPDRCALSGNYRLESNP ++ LSPLA AT Sbjct: 12 PPVQPDRCALSGNYRLESNPVRHDLSPLAAAT 43 >SB_34414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNPXKNXLSPLAXAT 927 PP QPDRCALSGNYRLES P ++ LSPLA AT Sbjct: 12 PPVQPDRCALSGNYRLESKPVRHDLSPLAAAT 43 >SB_38053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 57.2 bits (132), Expect = 2e-08 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNPXKNXLSPLAXAT 927 PP QPDRCALSGNYRLESNP + LSPL AT Sbjct: 64 PPVQPDRCALSGNYRLESNPGRPDLSPLGTAT 95 >SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) Length = 271 Score = 55.2 bits (127), Expect = 7e-08 Identities = 38/85 (44%), Positives = 44/85 (51%) Frame = +2 Query: 644 RFPPGKLPXCAPPVXXPCRFTRIPXPPFLPFGKAWXLPHXSRX*VSXXRCKVVRXQXGLC 823 RFP + P CA + PCR PPF +AW +S RC+ +C Sbjct: 145 RFPL-EAPSCAL-LFRPCRLPDT-CPPF-SLREAWRFLIAHAVGISV-RCRSFAPSWAVC 199 Query: 824 ARTPRFSPTAAPYPVTIVLSPTRXK 898 P FSPTAAPYPVTIVLSPTR K Sbjct: 200 TNPP-FSPTAAPYPVTIVLSPTRTK 223 >SB_54507| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 53.2 bits (122), Expect = 3e-07 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNPXKNXLSPLAXAT 927 PP Q DRCALSGNYRLESNP ++ +PLA AT Sbjct: 25 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 56 >SB_58426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 53.2 bits (122), Expect = 3e-07 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNPXKNXLSPLAXAT 927 PP Q DRCALSGNYRLESNP ++ +PLA AT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_57366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 53.2 bits (122), Expect = 3e-07 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNPXKNXLSPLAXAT 927 PP Q DRCALSGNYRLESNP ++ +PLA AT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_56245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 53.2 bits (122), Expect = 3e-07 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNPXKNXLSPLAXAT 927 PP Q DRCALSGNYRLESNP ++ +PLA AT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_55566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 53.2 bits (122), Expect = 3e-07 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNPXKNXLSPLAXAT 927 PP Q DRCALSGNYRLESNP ++ +PLA AT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_55077| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 53.2 bits (122), Expect = 3e-07 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNPXKNXLSPLAXAT 927 PP Q DRCALSGNYRLESNP ++ +PLA AT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_53790| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 53.2 bits (122), Expect = 3e-07 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNPXKNXLSPLAXAT 927 PP Q DRCALSGNYRLESNP ++ +PLA AT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_52894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 53.2 bits (122), Expect = 3e-07 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNPXKNXLSPLAXAT 927 PP Q DRCALSGNYRLESNP ++ +PLA AT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_51245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 45 Score = 53.2 bits (122), Expect = 3e-07 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNPXKNXLSPLAXAT 927 PP Q DRCALSGNYRLESNP ++ +PLA AT Sbjct: 13 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 44 >SB_48533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 53.2 bits (122), Expect = 3e-07 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNPXKNXLSPLAXAT 927 PP Q DRCALSGNYRLESNP ++ +PLA AT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_47211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 53.2 bits (122), Expect = 3e-07 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNPXKNXLSPLAXAT 927 PP Q DRCALSGNYRLESNP ++ +PLA AT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_46066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 53.2 bits (122), Expect = 3e-07 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNPXKNXLSPLAXAT 927 PP Q DRCALSGNYRLESNP ++ +PLA AT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_45109| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 53.2 bits (122), Expect = 3e-07 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNPXKNXLSPLAXAT 927 PP Q DRCALSGNYRLESNP ++ +PLA AT Sbjct: 139 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 170 >SB_43715| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 53.2 bits (122), Expect = 3e-07 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNPXKNXLSPLAXAT 927 PP Q DRCALSGNYRLESNP ++ +PLA AT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_42865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 53.2 bits (122), Expect = 3e-07 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNPXKNXLSPLAXAT 927 PP Q DRCALSGNYRLESNP ++ +PLA AT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_41269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 53.2 bits (122), Expect = 3e-07 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNPXKNXLSPLAXAT 927 PP Q DRCALSGNYRLESNP ++ +PLA AT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_40020| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 53.2 bits (122), Expect = 3e-07 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNPXKNXLSPLAXAT 927 PP Q DRCALSGNYRLESNP ++ +PLA AT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_38531| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 53.2 bits (122), Expect = 3e-07 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNPXKNXLSPLAXAT 927 PP Q DRCALSGNYRLESNP ++ +PLA AT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_35148| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 53.2 bits (122), Expect = 3e-07 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNPXKNXLSPLAXAT 927 PP Q DRCALSGNYRLESNP ++ +PLA AT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_31008| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 53.2 bits (122), Expect = 3e-07 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNPXKNXLSPLAXAT 927 PP Q DRCALSGNYRLESNP ++ +PLA AT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_30985| Best HMM Match : DUF1450 (HMM E-Value=1.5) Length = 599 Score = 53.2 bits (122), Expect = 3e-07 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNPXKNXLSPLAXAT 927 PP Q DRCALSGNYRLESNP ++ +PLA AT Sbjct: 368 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 399 >SB_29391| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 53.2 bits (122), Expect = 3e-07 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNPXKNXLSPLAXAT 927 PP Q DRCALSGNYRLESNP ++ +PLA AT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_24808| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 53.2 bits (122), Expect = 3e-07 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNPXKNXLSPLAXAT 927 PP Q DRCALSGNYRLESNP ++ +PLA AT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_23019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 53.2 bits (122), Expect = 3e-07 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNPXKNXLSPLAXAT 927 PP Q DRCALSGNYRLESNP ++ +PLA AT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_21707| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 53.2 bits (122), Expect = 3e-07 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNPXKNXLSPLAXAT 927 PP Q DRCALSGNYRLESNP ++ +PLA AT Sbjct: 32 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 63 >SB_19542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 53.2 bits (122), Expect = 3e-07 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNPXKNXLSPLAXAT 927 PP Q DRCALSGNYRLESNP ++ +PLA AT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_19098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 53.2 bits (122), Expect = 3e-07 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNPXKNXLSPLAXAT 927 PP Q DRCALSGNYRLESNP ++ +PLA AT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_19031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 53.2 bits (122), Expect = 3e-07 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNPXKNXLSPLAXAT 927 PP Q DRCALSGNYRLESNP ++ +PLA AT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_17805| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 53.2 bits (122), Expect = 3e-07 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNPXKNXLSPLAXAT 927 PP Q DRCALSGNYRLESNP ++ +PLA AT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_15695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 53.2 bits (122), Expect = 3e-07 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNPXKNXLSPLAXAT 927 PP Q DRCALSGNYRLESNP ++ +PLA AT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_12040| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 53.2 bits (122), Expect = 3e-07 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNPXKNXLSPLAXAT 927 PP Q DRCALSGNYRLESNP ++ +PLA AT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_9760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 53.2 bits (122), Expect = 3e-07 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNPXKNXLSPLAXAT 927 PP Q DRCALSGNYRLESNP ++ +PLA AT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_5267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 53.2 bits (122), Expect = 3e-07 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNPXKNXLSPLAXAT 927 PP Q DRCALSGNYRLESNP ++ +PLA AT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_3766| Best HMM Match : Moricin (HMM E-Value=5.1) Length = 108 Score = 53.2 bits (122), Expect = 3e-07 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNPXKNXLSPLAXAT 927 PP Q DRCALSGNYRLESNP ++ +PLA AT Sbjct: 76 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 107 >SB_1707| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 53.2 bits (122), Expect = 3e-07 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNPXKNXLSPLAXAT 927 PP Q DRCALSGNYRLESNP ++ +PLA AT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_1382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 53.2 bits (122), Expect = 3e-07 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNPXKNXLSPLAXAT 927 PP Q DRCALSGNYRLESNP ++ +PLA AT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_1275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 53.2 bits (122), Expect = 3e-07 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNPXKNXLSPLAXAT 927 PP Q DRCALSGNYRLESNP ++ +PLA AT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_27738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 52 Score = 49.2 bits (112), Expect = 5e-06 Identities = 20/25 (80%), Positives = 22/25 (88%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNPXKNXL 906 PP QPDRCALSGNYRLESNP ++ L Sbjct: 12 PPVQPDRCALSGNYRLESNPVRHRL 36 >SB_58224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_55737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_54286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_54219| Best HMM Match : Toxin_8 (HMM E-Value=8.1) Length = 75 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 56 PPVQPDRCALSGNYRLESNP 75 >SB_41217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_38325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_17471| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_16089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_9623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_59708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_59685| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_59589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_59479| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_58142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_57899| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_57889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_57793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_57693| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_57320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_55905| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_55790| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_55716| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_55631| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_55333| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_55090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_54702| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_54683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_54384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_53884| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 45 PPVQPDRCALSGNYRLESNP 64 >SB_53624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_53241| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_52929| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 35 Score = 47.2 bits (107), Expect = 2e-05 Identities = 20/27 (74%), Positives = 23/27 (85%) Frame = +1 Query: 844 PDRCALSGNYRLESNPXKNXLSPLAXA 924 PDRCALSGNYRLESNP ++ +PLA A Sbjct: 8 PDRCALSGNYRLESNPERHAKAPLAAA 34 >SB_52402| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_51349| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_51271| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_50626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_49587| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_49375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_49357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_49260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_49181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_48829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_48601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_48323| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_48037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_47484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_47382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_47359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_47312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_46998| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_46785| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_46606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_46553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_46274| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_46222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_46158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_45670| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_45556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_45238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_44797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_44462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_43465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_42828| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_42781| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_42533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_42195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_41845| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_40938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_39214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_38586| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_38311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_37725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_37267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_37229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_36145| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_35184| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_34961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_34855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_34644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_34569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_33632| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_33419| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_33059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_32948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_32667| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_32556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_31680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_31259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_30530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_30465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_30185| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_29900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_29015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_28377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_28369| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_28136| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_27976| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_27792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_27734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_26258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_26165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_25748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_25006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_24933| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_24744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_24530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_23602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_23082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_23076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_22933| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_22408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_22371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_21708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_21671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_21133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_21107| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_20737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_20572| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_19574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_19433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_18666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_17812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_17809| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_17259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_17176| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_16930| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_16732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_16453| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_15769| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_15576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_15019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_14967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_14861| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_14376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_14280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_14068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_12970| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_12483| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_12400| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_11534| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_11286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_11221| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_10946| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_10173| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_9717| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_9609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_9186| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_9181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_8946| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_8892| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_8840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_8665| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_8650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_8602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_8412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_8098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_7942| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_7762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_7701| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_6381| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 27 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 8 PPVQPDRCALSGNYRLESNP 27 >SB_5634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_5583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_5352| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_4816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_4803| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_4739| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_4616| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_4498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_4379| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_3983| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_3821| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_3004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_2988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_2927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_2917| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_2901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_2472| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_2187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_2000| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_1929| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_1735| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_1566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_1545| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_1521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_1469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_1412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_1338| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_1265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_756| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_338| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_305| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_33| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_49591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 42.7 bits (96), Expect = 4e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = +1 Query: 832 PPXQPDRCALSGNYRLESNP 891 PP QPDRCALSGNYRLE +P Sbjct: 12 PPVQPDRCALSGNYRLEVHP 31 >SB_1435| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 41.5 bits (93), Expect = 0.001 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = +2 Query: 833 PRFSPTAAPYPVTIVLSPT 889 P FSPTAAPYPVTIVLSPT Sbjct: 44 PPFSPTAAPYPVTIVLSPT 62 >SB_59645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 38.3 bits (85), Expect = 0.009 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = +2 Query: 290 ALMNRPXRGERRVAYWAL 343 ALMNRP RGERR AYWAL Sbjct: 46 ALMNRPTRGERRFAYWAL 63 >SB_59631| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 38.3 bits (85), Expect = 0.009 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = +2 Query: 290 ALMNRPXRGERRVAYWAL 343 ALMNRP RGERR AYWAL Sbjct: 117 ALMNRPTRGERRFAYWAL 134 >SB_59194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 38.3 bits (85), Expect = 0.009 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = +2 Query: 290 ALMNRPXRGERRVAYWAL 343 ALMNRP RGERR AYWAL Sbjct: 26 ALMNRPTRGERRFAYWAL 43 >SB_58955| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 38.3 bits (85), Expect = 0.009 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = +2 Query: 290 ALMNRPXRGERRVAYWAL 343 ALMNRP RGERR AYWAL Sbjct: 74 ALMNRPTRGERRFAYWAL 91 >SB_58947| Best HMM Match : Helicase_C (HMM E-Value=0.058) Length = 168 Score = 38.3 bits (85), Expect = 0.009 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = +2 Query: 290 ALMNRPXRGERRVAYWAL 343 ALMNRP RGERR AYWAL Sbjct: 122 ALMNRPTRGERRFAYWAL 139 >SB_58783| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 38.3 bits (85), Expect = 0.009 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = +2 Query: 290 ALMNRPXRGERRVAYWAL 343 ALMNRP RGERR AYWAL Sbjct: 83 ALMNRPTRGERRFAYWAL 100 >SB_58676| Best HMM Match : FUN14 (HMM E-Value=0.16) Length = 217 Score = 38.3 bits (85), Expect = 0.009 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = +2 Query: 290 ALMNRPXRGERRVAYWAL 343 ALMNRP RGERR AYWAL Sbjct: 121 ALMNRPTRGERRFAYWAL 138 >SB_58639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 38.3 bits (85), Expect = 0.009 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = +2 Query: 290 ALMNRPXRGERRVAYWAL 343 ALMNRP RGERR AYWAL Sbjct: 26 ALMNRPTRGERRFAYWAL 43 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,194,031 Number of Sequences: 59808 Number of extensions: 376640 Number of successful extensions: 1714 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 1559 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1712 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2693287426 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -