BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_B17 (928 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl s... 28 0.46 AY330172-1|AAQ16278.1| 170|Anopheles gambiae odorant-binding pr... 27 1.1 >AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl symporter protein. Length = 1127 Score = 27.9 bits (59), Expect = 0.46 Identities = 9/24 (37%), Positives = 17/24 (70%) Frame = +2 Query: 56 GRGFPLXRVIGSDMIRYIDEFGQT 127 G+GF +V+G D +++I E+ +T Sbjct: 819 GKGFDYSQVLGEDTVKFISEYPRT 842 >AY330172-1|AAQ16278.1| 170|Anopheles gambiae odorant-binding protein AgamOBP52 protein. Length = 170 Score = 26.6 bits (56), Expect = 1.1 Identities = 14/38 (36%), Positives = 17/38 (44%) Frame = +1 Query: 631 KXTRPFPPWKAPSLRPXCXRXLPLYPXTXSAXSPLRES 744 K + FPP K S P C + PL P S RE+ Sbjct: 18 KHPKQFPPSKKQSELPYCCQTEPLIPEHVSTKCKEREA 55 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 736,860 Number of Sequences: 2352 Number of extensions: 12200 Number of successful extensions: 13 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 100882044 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -