BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_B10 (917 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_06_0222 + 26510472-26511698 29 3.9 10_03_0029 + 7196149-7196213,7196303-7196424,7197616-7197822,719... 29 6.8 >05_06_0222 + 26510472-26511698 Length = 408 Score = 29.5 bits (63), Expect = 3.9 Identities = 16/29 (55%), Positives = 18/29 (62%), Gaps = 2/29 (6%) Frame = -3 Query: 279 DGSKWLVFSDASF--LVRCLPTRGP*KCA 199 D KWL +A F L RCLP RGP KC+ Sbjct: 376 DNGKWL---EAPFIRLDRCLPERGPSKCS 401 >10_03_0029 + 7196149-7196213,7196303-7196424,7197616-7197822, 7197904-7198091,7198493-7198628,7198973-7199069, 7199200-7199300,7199644-7199807,7200029-7200217, 7200590-7200711,7200961-7200979 Length = 469 Score = 28.7 bits (61), Expect = 6.8 Identities = 13/50 (26%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = +3 Query: 150 QKHSLTNTNYYNF-DHDKHIFTGHGWVSSAPRKKRLKTPTTSIRPGHSRK 296 +K+ + N +N D + H S+AP K +T ++ ++ H RK Sbjct: 107 EKYEINGENEFNVSDSEMEELVSHEEASAAPSKSSFETDSSDVKIEHKRK 156 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,479,276 Number of Sequences: 37544 Number of extensions: 347252 Number of successful extensions: 747 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 733 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 747 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2612387020 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -