BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_B10 (917 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014134-2140|AAF53151.1| 69|Drosophila melanogaster CG6770-PA... 55 1e-07 >AE014134-2140|AAF53151.1| 69|Drosophila melanogaster CG6770-PA protein. Length = 69 Score = 55.2 bits (127), Expect = 1e-07 Identities = 28/50 (56%), Positives = 31/50 (62%) Frame = +2 Query: 146 MSEAFFDEYELL*FRPRQAHFHGPRVGKQRTKKEASENTNHFDPSGAFEK 295 MSEA FDEYE F H GKQR K+EA+E+TNHFDPSG K Sbjct: 1 MSEAHFDEYEHYNF-DHDKHIFSGHSGKQRNKREANEHTNHFDPSGHSRK 49 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 31,033,306 Number of Sequences: 53049 Number of extensions: 601709 Number of successful extensions: 1134 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1096 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1132 length of database: 24,988,368 effective HSP length: 85 effective length of database: 20,479,203 effective search space used: 4505424660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -