BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_B07 (1116 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47598| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.9 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 24 8.0 >SB_47598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2332 Score = 29.9 bits (64), Expect = 3.9 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = -2 Query: 422 TPPPPPXXXXPFFFFXXXXATGFPKFCXXGXPXTXXPP 309 TPPPPP P F + F KF P T P Sbjct: 1922 TPPPPPPTPLPEFITQFKGSLWFEKFYPDAQPDTFPKP 1959 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 23.8 bits (49), Expect(2) = 8.0 Identities = 9/21 (42%), Positives = 9/21 (42%) Frame = -1 Query: 867 PPPPPPGXXKXXFFFXXXXPP 805 PPPPPP F PP Sbjct: 282 PPPPPPSNTPGMFASSGFQPP 302 Score = 23.4 bits (48), Expect(2) = 8.0 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = -1 Query: 735 PPXXXFFXPPPPP 697 PP F PPPPP Sbjct: 303 PPPPTDFAPPPPP 315 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,249,928 Number of Sequences: 59808 Number of extensions: 335119 Number of successful extensions: 1327 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 401 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1131 length of database: 16,821,457 effective HSP length: 83 effective length of database: 11,857,393 effective search space used: 3414929184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -