BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_B06 (934 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 23 4.0 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 23 4.0 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 23 5.2 Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP... 22 6.9 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 22 9.2 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 23.0 bits (47), Expect = 4.0 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = -2 Query: 582 DQTLFDERLHSLXRCPRNRRXENWILPDWSVGKREPSS 469 D++ FDE S + R +N DWSVGK+ +S Sbjct: 16 DESYFDEGGRSYGK-GRGFIIQNNNNDDWSVGKKNSNS 52 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 23.0 bits (47), Expect = 4.0 Identities = 13/42 (30%), Positives = 20/42 (47%) Frame = -3 Query: 452 SVSGTDPSTERSDCPGSPAGHRAPSPGDETCSTVSKL*TDLP 327 S SG + TE+ D P S + AP+ + + K D+P Sbjct: 578 SDSGIESGTEKPDKPASSSASSAPTSVCSSPRSEDKEVEDMP 619 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 22.6 bits (46), Expect = 5.2 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = -1 Query: 271 VSVNIGTVDVSVANVNGILDCLRHLAWLR 185 V VN G V + NVN ++ WLR Sbjct: 52 VHVNFGLAFVQLINVNEKNQIMKSNVWLR 80 >Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP57-1 protein. Length = 544 Score = 22.2 bits (45), Expect = 6.9 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = +1 Query: 268 KREGSRRSYNQQN*GRSRNEGRSVHN 345 KR G+R++ NQ N + VH+ Sbjct: 514 KRNGNRQNDNQNNQNDNNRNDNQVHH 539 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 21.8 bits (44), Expect = 9.2 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +3 Query: 603 LQTRSSWRGCCSTRLSSRSSIRW 671 L +S CS R S+ S +RW Sbjct: 9 LPVKSFRESRCSVRCSAASGLRW 31 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 246,036 Number of Sequences: 438 Number of extensions: 5246 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 30476628 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -