BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_B04 (918 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_49946| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 5.4 SB_19782| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.0 >SB_49946| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 25.0 bits (52), Expect(2) = 5.4 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +3 Query: 21 SAXTXKVIVRILQAT*RSGSIMKRTATSSCPVC 119 S K V+ L A + +K +TSSCP+C Sbjct: 33 SPPASKEAVQALPAVEVTDKHLKELSTSSCPIC 65 Score = 22.6 bits (46), Expect(2) = 5.4 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = +3 Query: 99 TSSCPVCRRGL 131 T+SCPVCR L Sbjct: 96 TNSCPVCRHEL 106 >SB_19782| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 728 Score = 28.7 bits (61), Expect = 7.0 Identities = 13/56 (23%), Positives = 23/56 (41%) Frame = +1 Query: 196 TLHPHKCFNXQISTLLRDQKETAVGXLEKSSALFVDERMIVQKNXXGXAENWCLWG 363 T+HP + + ++ D + +K V R ++ K G + WC WG Sbjct: 610 TIHPVCAISHGDTFIVSDYGNDVIHVFDKQEGA-VTRRCVIGKQGSGDGDLWCPWG 664 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,619,752 Number of Sequences: 59808 Number of extensions: 360567 Number of successful extensions: 643 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 584 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 643 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2657535823 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -