BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_B03 (881 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P... 25 4.0 AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta... 23 9.3 >AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P450 reductase protein. Length = 679 Score = 24.6 bits (51), Expect = 4.0 Identities = 13/35 (37%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Frame = -1 Query: 230 WNXLGVVFDV-LEEVGSVASHHRSLGQSDAGEENY 129 +N +G+ D LEE+G+ LG DA E+Y Sbjct: 184 YNKVGIYVDKRLEELGANRVFELGLGDDDANIEDY 218 >AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing phosphoprotein protein. Length = 1200 Score = 23.4 bits (48), Expect = 9.3 Identities = 13/36 (36%), Positives = 24/36 (66%), Gaps = 1/36 (2%) Frame = -2 Query: 430 RALDVLPRLFQSLLGLAV-RVSERSLETLGEGVELL 326 RALD+ P+ +L+GLA+ +++ E+ GV++L Sbjct: 222 RALDLEPQCVGALVGLAILKLNLHEPESNRMGVQML 257 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 618,322 Number of Sequences: 2352 Number of extensions: 9963 Number of successful extensions: 27 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 94680279 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -