BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_B02 (844 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12466| Best HMM Match : Transferrin (HMM E-Value=4.4e-21) 56 5e-08 SB_5632| Best HMM Match : XRN_N (HMM E-Value=3.9) 29 4.7 SB_33226| Best HMM Match : ubiquitin (HMM E-Value=5.6) 29 6.2 >SB_12466| Best HMM Match : Transferrin (HMM E-Value=4.4e-21) Length = 291 Score = 55.6 bits (128), Expect = 5e-08 Identities = 36/139 (25%), Positives = 65/139 (46%), Gaps = 5/139 (3%) Frame = +1 Query: 136 NAAKTTYKICVPSQHLKACQXIVDIPTK-----SKVTLDCIPARDRMECLNYVQQRQADF 300 NA K C+ ++ CQ + + ++ V L C+ +C++ +Q+ +AD Sbjct: 22 NAPKLGRWCCISDAEVEKCQALAHVASRVVTSNETVNLTCVRGDGVTDCMSRIQRDEADL 81 Query: 301 VPVXPEDMYVAAKIPNQDFVVFQEYRTDEEPDAPFRYEAVIVIHKDLPINNLDQLKGLKS 480 V + ED+Y+A VV ++Y + D Y AV ++ + N+ LKG + Sbjct: 82 VTLGEEDIYIAGAKYGLRPVVAEDYGS---KDKHIHY-AVALVRSTTTV-NITTLKGAIT 136 Query: 481 CHTGVNRNVGYKIPLXMLM 537 CH +G+KIP+ L+ Sbjct: 137 CHPRAEDMIGWKIPVGFLI 155 >SB_5632| Best HMM Match : XRN_N (HMM E-Value=3.9) Length = 766 Score = 29.1 bits (62), Expect = 4.7 Identities = 19/54 (35%), Positives = 27/54 (50%), Gaps = 4/54 (7%) Frame = -1 Query: 391 VLHRFCTPGKRRS-PDWVFWRPRTCLRXQ-LERNRLASAERNSDTPFYL--WRE 242 +LH CTPG+RRS + + P +R + L N +R S T +L W E Sbjct: 163 LLHNTCTPGQRRSEKKYYYTTPARLVREEVLLHNTCTPGQRRSITTQHLHAWSE 216 Score = 28.7 bits (61), Expect = 6.2 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -1 Query: 391 VLHRFCTPGKRRSPDWVFWRPRTCL 317 +LH CTPG+RRS ++ CL Sbjct: 628 LLHNTCTPGQRRSEKKYYYTTLACL 652 Score = 28.3 bits (60), Expect = 8.2 Identities = 11/38 (28%), Positives = 21/38 (55%) Frame = -1 Query: 391 VLHRFCTPGKRRSPDWVFWRPRTCLRXQLERNRLASAE 278 +LH+ C PG+RRS ++ CL + +R + + + Sbjct: 678 LLHKTCMPGQRRSEKKYYYTTPACLVREDQRRSIITQQ 715 >SB_33226| Best HMM Match : ubiquitin (HMM E-Value=5.6) Length = 211 Score = 28.7 bits (61), Expect = 6.2 Identities = 14/53 (26%), Positives = 25/53 (47%) Frame = +1 Query: 385 EEPDAPFRYEAVIVIHKDLPINNLDQLKGLKSCHTGVNRNVGYKIPLXMLMKR 543 E+P+ PFRY ++HK + + +L H + + G+ P+ L R Sbjct: 113 EDPEEPFRYVFDWIVHKGMSVRECKEL-----LHPELQQRYGFNCPVDHLRLR 160 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,495,392 Number of Sequences: 59808 Number of extensions: 460969 Number of successful extensions: 841 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 731 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 838 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2383424791 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -