BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_A24 (946 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC23E6.04c |utp10||U3 snoRNP-associated protein Utp10 |Schizos... 29 0.72 SPBC17G9.05 |rct1|cyp6|RRM-containing cyclophilin regulating tra... 28 2.2 SPAC18G6.05c |||translation elongation regulator Gcn1 |Schizosac... 27 3.8 SPBC32F12.01c ||SPBC685.10c|inositol phosphosphingolipid phospho... 26 6.7 SPAC26F1.09 |gyp51||GTPase activating protein Gyp51 |Schizosacch... 26 8.9 SPBC21.06c |cdc7|pld1, its10|serine/threonine protein kinase Cdc... 26 8.9 >SPBC23E6.04c |utp10||U3 snoRNP-associated protein Utp10 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1649 Score = 29.5 bits (63), Expect = 0.72 Identities = 12/47 (25%), Positives = 24/47 (51%) Frame = -2 Query: 744 IGFVXEVVVFLVNAILSCGFRINEXMLHLCYVNFLQHFHIHKHFRVY 604 I + + V +++A++ G + +L C+VN H H+ R+Y Sbjct: 917 IHVIEQTVKTVISALIRLGKDFDSSLLVSCFVNAFPHIPQHRRLRLY 963 >SPBC17G9.05 |rct1|cyp6|RRM-containing cyclophilin regulating transcription Rct1|Schizosaccharomyces pombe|chr 2|||Manual Length = 432 Score = 27.9 bits (59), Expect = 2.2 Identities = 11/24 (45%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -1 Query: 310 RYHSLCQFYNIHHQ--CLVGSHLG 245 +Y++ C FYNI H C G LG Sbjct: 35 KYYNFCPFYNIQHNYTCQTGDPLG 58 >SPAC18G6.05c |||translation elongation regulator Gcn1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 2670 Score = 27.1 bits (57), Expect = 3.8 Identities = 12/46 (26%), Positives = 24/46 (52%) Frame = +1 Query: 658 KMQHGLINPEAAAKYGIHKENDYFVYKANYSNAVLYNNEEQRLTYF 795 ++ H L + K K ND F++ + +N + N+++ +L YF Sbjct: 528 RISHTLELQDILVKLSTPKNNDVFIFSSKITNKL--NDDQSKLWYF 571 >SPBC32F12.01c ||SPBC685.10c|inositol phosphosphingolipid phospholipase C |Schizosaccharomyces pombe|chr 2|||Manual Length = 424 Score = 26.2 bits (55), Expect = 6.7 Identities = 13/43 (30%), Positives = 21/43 (48%) Frame = +1 Query: 142 IAVALSSAVPKPSTIKSKNVDAVFVEKQKKILSFFQDVSQLNT 270 +A L PST ++KN VF+E+ K+ + D + T Sbjct: 252 VAKRLDYVFHSPSTCEAKNAKVVFLERVPKLDCSYSDHFAIET 294 >SPAC26F1.09 |gyp51||GTPase activating protein Gyp51 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1031 Score = 25.8 bits (54), Expect = 8.9 Identities = 14/33 (42%), Positives = 21/33 (63%), Gaps = 2/33 (6%) Frame = +1 Query: 235 LSFF--QDVSQLNTDDEYYKIGKDYDIEMNMDN 327 L+FF Q+V Q+N +DEY + + D E +DN Sbjct: 49 LNFFSTQNVMQMNFEDEYSEFSNE-DDEAEIDN 80 >SPBC21.06c |cdc7|pld1, its10|serine/threonine protein kinase Cdc7|Schizosaccharomyces pombe|chr 2|||Manual Length = 1062 Score = 25.8 bits (54), Expect = 8.9 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +2 Query: 686 KPQLSMAFTRKTTTSXTKPIILTPFYTIMKN 778 +P + F K T TKPI++ + IMK+ Sbjct: 956 QPIIFQKFKEKLTHKGTKPIVVLNIFQIMKS 986 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,030,676 Number of Sequences: 5004 Number of extensions: 58058 Number of successful extensions: 185 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 169 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 185 length of database: 2,362,478 effective HSP length: 73 effective length of database: 1,997,186 effective search space used: 481321826 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -