BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_A24 (946 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_1040 - 23873354-23874509,23875645-23875796 32 0.76 03_02_0186 - 6243487-6243799,6243892-6244400,6244495-6244557,624... 31 1.0 12_01_1025 - 10506144-10506226,10506643-10506699,10507502-105076... 30 3.1 11_01_0419 + 3226224-3226756,3228010-3228169,3228256-3228435,322... 29 4.1 06_02_0019 - 10656005-10657511,10657712-10658739 29 5.4 02_03_0412 - 18749430-18749587,18749696-18749857,18750062-187501... 29 5.4 01_01_0635 - 4795434-4795461,4795897-4797365 29 7.1 10_01_0003 + 46158-46428,46588-46706,46819-46928,48977-49415,495... 28 9.4 >08_02_1040 - 23873354-23874509,23875645-23875796 Length = 435 Score = 31.9 bits (69), Expect = 0.76 Identities = 18/64 (28%), Positives = 30/64 (46%), Gaps = 3/64 (4%) Frame = -3 Query: 218 STNTASTFFDFMVLGFGTALLSATAIKPSQESRQTSW-FPALXXNXSXSXR--DSXXXXA 48 ST T+STF + M L +++A+ + + ++R +SW P + R D Sbjct: 355 STPTSSTFLEEMALPLAAPIMAASVVTAASKARVSSWCLPGMAAAPHCCGRGGDGGVRGG 414 Query: 47 XCGG 36 CGG Sbjct: 415 GCGG 418 >03_02_0186 - 6243487-6243799,6243892-6244400,6244495-6244557, 6245482-6245681,6246125-6246519,6246776-6246888 Length = 530 Score = 31.5 bits (68), Expect = 1.0 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = +3 Query: 492 CLFCACASQSRSILVCLLHRCYPAP 566 CLFC SR ILVC L RC AP Sbjct: 58 CLFCEANFISRRILVCDLLRCLVAP 82 >12_01_1025 - 10506144-10506226,10506643-10506699,10507502-10507605, 10507884-10507937,10508107-10508193,10509027-10509214, 10509793-10509854,10510084-10510354,10510756-10510834, 10511715-10511913,10512816-10512960,10513324-10513416, 10514449-10514736 Length = 569 Score = 29.9 bits (64), Expect = 3.1 Identities = 16/37 (43%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = +1 Query: 475 ETFYKSACFARVHLNQGQFLYAF-YIAVIQRPDCHGF 582 ETF+ +AC R HL QG+ + A+ Y+ + DC GF Sbjct: 427 ETFFTTACMGRGHLCQGKLVDAYRYLHKEKDMDC-GF 462 >11_01_0419 + 3226224-3226756,3228010-3228169,3228256-3228435, 3228525-3228659,3229262-3229344,3229442-3229535, 3229649-3229735 Length = 423 Score = 29.5 bits (63), Expect = 4.1 Identities = 17/41 (41%), Positives = 23/41 (56%) Frame = -2 Query: 627 IHKHFRVYFIRSRNNETVAIRALDNSDVEGIQELTLIEMHT 505 IHK FR++ R + E +AIRA NS + L L +M T Sbjct: 319 IHKPFRIHLGRGLHGECLAIRADGNSKLSHEIGLELSKMST 359 >06_02_0019 - 10656005-10657511,10657712-10658739 Length = 844 Score = 29.1 bits (62), Expect = 5.4 Identities = 10/32 (31%), Positives = 24/32 (75%), Gaps = 1/32 (3%) Frame = -3 Query: 638 STSIFINILGY-TSYGAGTTKPWQSGRWITAM 546 +T+I ++++G +YGAG+++ W++ ++ AM Sbjct: 750 NTTIVLDMIGLLVAYGAGSSREWETSGYVIAM 781 >02_03_0412 - 18749430-18749587,18749696-18749857,18750062-18750194, 18751640-18751744,18751818-18751935,18752232-18752320, 18752407-18753660,18753785-18753831,18754285-18754339, 18754783-18754884 Length = 740 Score = 29.1 bits (62), Expect = 5.4 Identities = 16/53 (30%), Positives = 29/53 (54%), Gaps = 2/53 (3%) Frame = -2 Query: 693 CGFRINEXMLHLCYVNFLQHFHIHKHFRVYFI-RSRNNETVAIRAL-DNSDVE 541 C I+ L+ Y+ +QHFH+ + + RS+N+ T +I+ L D S ++ Sbjct: 278 CFMMISTKELYTIYITQVQHFHVGDNVTFTLLSRSKNSLTPSIKNLTDESTID 330 >01_01_0635 - 4795434-4795461,4795897-4797365 Length = 498 Score = 28.7 bits (61), Expect = 7.1 Identities = 17/46 (36%), Positives = 23/46 (50%) Frame = +1 Query: 673 LINPEAAAKYGIHKENDYFVYKANYSNAVLYNNEEQRLTYFTXGYW 810 +I+P+ KY DYFVY AN S++ +N LT YW Sbjct: 155 IISPD---KYARPSAIDYFVYNANSSSS---SNHHPSLTRLPVSYW 194 >10_01_0003 + 46158-46428,46588-46706,46819-46928,48977-49415, 49511-49633,49805-50106,50143-50350,50729-51448 Length = 763 Score = 28.3 bits (60), Expect = 9.4 Identities = 16/63 (25%), Positives = 27/63 (42%) Frame = -1 Query: 373 SCTSSEILQQLXX*CSCPYSFRYHSLCQFYNIHHQCLVGSHLGRRTEFSFAFQQIRHPHF 194 +C S+ L+ L C Y + H C++ S + + E ++RHPH Sbjct: 478 TCKFSDSLKVLPRGLGCVYKGEIMNRSVMIYKLHSCIIQSSMQFQQEVHL-ISKVRHPHL 536 Query: 193 LTL 185 +TL Sbjct: 537 VTL 539 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,242,478 Number of Sequences: 37544 Number of extensions: 354402 Number of successful extensions: 793 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 774 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 793 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2717819680 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -