BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_A22 (891 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBP4H10.19c |||calreticulin/calnexin homolog|Schizosaccharomyce... 27 3.6 SPAC1805.01c |ppk6|SPAPJ736.02c|serine/threonine protein kinase ... 27 4.7 SPBC8D2.18c |||adenosylhomocysteinase |Schizosaccharomyces pombe... 26 6.3 >SPBP4H10.19c |||calreticulin/calnexin homolog|Schizosaccharomyces pombe|chr 2|||Manual Length = 381 Score = 27.1 bits (57), Expect = 3.6 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +1 Query: 130 SKWATPLSRSSFSPSFGVWLVLFAPFSHLKDK 225 S+W P+++ GVW ++ AP SHL+D+ Sbjct: 47 SRWRAPVNKD-----LGVWDLVEAPGSHLRDE 73 >SPAC1805.01c |ppk6|SPAPJ736.02c|serine/threonine protein kinase Ppk6|Schizosaccharomyces pombe|chr 1|||Manual Length = 775 Score = 26.6 bits (56), Expect = 4.7 Identities = 19/56 (33%), Positives = 27/56 (48%) Frame = +1 Query: 82 LFENNRN*KEISKFIISKWATPLSRSSFSPSFGVWLVLFAPFSHLKDKQRDYSSGV 249 L ++ N +I IIS +P S S P+FGVWL+ + + D R S V Sbjct: 412 LIHSDGNIIQIDCQIIS--VSPHSVKSNEPAFGVWLIFDSVDNRASDFVRSMRSSV 465 >SPBC8D2.18c |||adenosylhomocysteinase |Schizosaccharomyces pombe|chr 2|||Manual Length = 433 Score = 26.2 bits (55), Expect = 6.3 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +3 Query: 201 PIFAPKGQTEGLFKWC 248 P+FA KG+TE + WC Sbjct: 97 PVFAWKGETEEEYLWC 112 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,809,360 Number of Sequences: 5004 Number of extensions: 53021 Number of successful extensions: 101 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 100 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 101 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 448490560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -