BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_A22 (891 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_1023 - 23710825-23710950,23711037-23711120,23711367-237114... 30 2.1 05_07_0202 - 28378825-28379433,28382242-28382856 29 5.0 >08_02_1023 - 23710825-23710950,23711037-23711120,23711367-23711492, 23711593-23711712,23712046-23712153,23712243-23712395, 23712505-23712600,23712716-23712800,23713278-23714268, 23714870-23714915,23715806-23715964,23716516-23716651, 23716734-23716900,23717366-23717696,23717827-23718062, 23718326-23718514 Length = 1050 Score = 30.3 bits (65), Expect = 2.1 Identities = 16/63 (25%), Positives = 28/63 (44%) Frame = +1 Query: 160 SFSPSFGVWLVLFAPFSHLKDKQRDYSSGVNINGSDLLVVLGCVLTWAQMNPLIGPRLSN 339 S++ FG W V F P + D++ + S V + L+ G ++ W+ L G L Sbjct: 396 SWAAHFGRWGVFFPPPTPQADEEEEQGSSVEMLEELLIFTRGGLILWSSCRALGGAALKG 455 Query: 340 EXL 348 + Sbjct: 456 SPI 458 >05_07_0202 - 28378825-28379433,28382242-28382856 Length = 407 Score = 29.1 bits (62), Expect = 5.0 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -3 Query: 97 DYSQTKYQLPPRWWIPK 47 D + KY +PPRWW+ K Sbjct: 371 DALKDKYPVPPRWWVSK 387 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,153,914 Number of Sequences: 37544 Number of extensions: 345460 Number of successful extensions: 587 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 581 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 587 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2506954360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -