BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_A20 (1232 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_02_0603 - 11150739-11150746,11150791-11151340 31 2.5 07_03_0600 + 19866757-19867218,19867920-19868429 30 3.3 01_03_0005 + 11568545-11569119,11569179-11569191 30 3.3 08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132,330... 30 4.3 02_05_0686 - 30900748-30902167,30903442-30904742 30 4.3 12_02_0299 - 17051570-17052474,17053542-17053755 29 5.7 03_05_0067 - 20460206-20460703,20461255-20461530 29 5.7 01_06_1377 + 36764461-36765339 29 5.7 08_01_0600 - 5262573-5262773,5262850-5262952,5263050-5263180,526... 29 7.5 04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062,943... 29 7.5 12_01_0752 - 6798938-6799312,6799628-6799768,6800257-6800325,680... 29 9.9 09_06_0083 + 20753191-20754480 29 9.9 01_06_1731 + 39516897-39517632,39517744-39517912,39517985-395184... 29 9.9 01_06_1682 - 39130696-39131705,39132355-39132583 29 9.9 >09_02_0603 - 11150739-11150746,11150791-11151340 Length = 185 Score = 30.7 bits (66), Expect = 2.5 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 1096 PXXGGGXXPPPPLXVXFXXPPHQKYXFXXPPPP 1194 P G PPPPL F PP + PPPP Sbjct: 55 PLPQSGVPPPPPLGSFFVPPPQSR---VPPPPP 84 >07_03_0600 + 19866757-19867218,19867920-19868429 Length = 323 Score = 30.3 bits (65), Expect = 3.3 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 2/46 (4%) Frame = +1 Query: 1096 PXXGGGXX--PPPPLXVXFXXPPHQKYXFXXPPPPFFFXXXGPXPP 1227 P GG PPPP PPH Y PP P + P PP Sbjct: 7 PTMNGGHHAAPPPPQVSGAPPPPHGHYQQQPPPQP-YCQQQQPLPP 51 >01_03_0005 + 11568545-11569119,11569179-11569191 Length = 195 Score = 30.3 bits (65), Expect = 3.3 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +1 Query: 1105 GGGXXPPPPLXVXFXXPPHQKYXFXXPPPPFF 1200 GGG P PP F P+ + + PPPPF+ Sbjct: 133 GGGAYPTPPPPNPFL--PYFPFYYYSPPPPFY 162 >08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132, 3308247-3308315,3308427-3308513,3308753-3308858, 3309118-3309237,3309327-3309406,3309497-3309878, 3310746-3310814,3311460-3312202 Length = 644 Score = 29.9 bits (64), Expect = 4.3 Identities = 18/49 (36%), Positives = 20/49 (40%), Gaps = 5/49 (10%) Frame = +1 Query: 1096 PXXGGGXXPPPPLXVXFXXPPHQK--YXFXXPP---PPFFFXXXGPXPP 1227 P GG P PP + PP Q+ Y PP PP F P PP Sbjct: 12 PPPQGGFPPQPPPMNPYGPPPPQQPAYGHMPPPQGAPPPFLAPPPPPPP 60 Score = 29.1 bits (62), Expect = 7.5 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +1 Query: 1120 PPPPLXVXFXXPPHQKYXFXXPPPPFFFXXXGPXPP 1227 PPPP F P PPPP + P PP Sbjct: 62 PPPPHQPQFNFGPGPPQQQQPPPPPQMYYQPPPPPP 97 Score = 28.7 bits (61), Expect = 9.9 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +1 Query: 1120 PPPPLXVXFXXPPHQKYXFXXPPPPFFFXXXGPXPP 1227 P PP PP Y PPPP+ P PP Sbjct: 74 PGPPQQQQPPPPPQMYYQPPPPPPPYGVNSSQPPPP 109 >02_05_0686 - 30900748-30902167,30903442-30904742 Length = 906 Score = 29.9 bits (64), Expect = 4.3 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 1120 PPPPLXVXFXXPPHQKYXFXXPPPPFFFXXXGPXPP 1227 PPPP PP K PPPP GP PP Sbjct: 345 PPPPPAKGPPPPPPPKGPSPPPPPPPGGKKGGPPPP 380 >12_02_0299 - 17051570-17052474,17053542-17053755 Length = 372 Score = 29.5 bits (63), Expect = 5.7 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 1120 PPPPLXVXFXXPPHQKYXFXXPPPPFFFXXXGPXP 1224 PPPP + F PP PPPP F P P Sbjct: 234 PPPPPFLPFPLPPIPFLTPPSPPPPAFPFPLPPWP 268 >03_05_0067 - 20460206-20460703,20461255-20461530 Length = 257 Score = 29.5 bits (63), Expect = 5.7 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +1 Query: 1120 PPPPLXVXFXXPPHQKYXFXXPPPPFFFXXXGPXPP 1227 PPPP PP +Y PPPP G PP Sbjct: 4 PPPPPQWAMGPPPPPQYFQAGPPPPPPQYFQGAHPP 39 >01_06_1377 + 36764461-36765339 Length = 292 Score = 29.5 bits (63), Expect = 5.7 Identities = 13/36 (36%), Positives = 16/36 (44%) Frame = +1 Query: 1123 PPPLXVXFXXPPHQKYXFXXPPPPFFFXXXGPXPPK 1230 PPP + P Y F PPPP + P PP+ Sbjct: 155 PPPPEPQYPPPSSSPYYFPPPPPPAY---SAPPPPQ 187 >08_01_0600 - 5262573-5262773,5262850-5262952,5263050-5263180, 5263263-5263312,5265266-5265725,5266349-5266708 Length = 434 Score = 29.1 bits (62), Expect = 7.5 Identities = 14/41 (34%), Positives = 18/41 (43%) Frame = +1 Query: 1108 GGXXPPPPLXVXFXXPPHQKYXFXXPPPPFFFXXXGPXPPK 1230 GG PP PHQ+ + PPPP + P PP+ Sbjct: 14 GGGGAPPQWGAIPPPVPHQQQQY-APPPPQMWGQAPPPPPQ 53 >04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062, 9435445-9435526,9435610-9435660,9435749-9435829, 9435965-9436006,9436117-9436215,9438130-9438201, 9438557-9438680,9438850-9439723,9440274-9440456, 9440941-9442741,9442825-9443049,9443117-9443814, 9444519-9444591 Length = 1541 Score = 29.1 bits (62), Expect = 7.5 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +1 Query: 1105 GGGXXPPPPLXVXFXXPPHQKYXFXXPPPP 1194 GG PPPP PP + PPPP Sbjct: 1158 GGPPAPPPPAGFRGGTPPPNAHGGVAPPPP 1187 >12_01_0752 - 6798938-6799312,6799628-6799768,6800257-6800325, 6800407-6800454,6801740-6801836,6801922-6802001, 6802099-6802170,6802335-6802429,6802853-6802934, 6805476-6805853 Length = 478 Score = 28.7 bits (61), Expect = 9.9 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +1 Query: 1120 PPPPLXVXFXXPPHQKYXFXXPPPP 1194 PPP + V PP + F PPPP Sbjct: 47 PPPVIRVFAAAPPPPRAAFFAPPPP 71 >09_06_0083 + 20753191-20754480 Length = 429 Score = 28.7 bits (61), Expect = 9.9 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +1 Query: 1120 PPPPLXVXFXXPPHQKYXFXXPPPPFFFXXXGPXPP 1227 PPPP + P Q PP P F P PP Sbjct: 262 PPPPPADTYPVSPDQPLYSSPPPAPTAFVPHTPLPP 297 >01_06_1731 + 39516897-39517632,39517744-39517912,39517985-39518488, 39518619-39518747,39519849-39519990,39520082-39520453 Length = 683 Score = 28.7 bits (61), Expect = 9.9 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +1 Query: 1144 FXXPPHQKYXFXXPPPPFFFXXXGPXPP 1227 F PHQ Y PPPP+ P PP Sbjct: 37 FQQLPHQLYCPQPPPPPYQVMPVPPPPP 64 >01_06_1682 - 39130696-39131705,39132355-39132583 Length = 412 Score = 28.7 bits (61), Expect = 9.9 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +1 Query: 1120 PPPPLXVXFXXPPHQKYXFXXPPPPFFFXXXGP 1218 PPPP PP KY PPP++F P Sbjct: 259 PPPPYGYNSPIPPTNKYL----PPPYYFNSPPP 287 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,970,496 Number of Sequences: 37544 Number of extensions: 283909 Number of successful extensions: 702 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 467 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 646 length of database: 14,793,348 effective HSP length: 84 effective length of database: 11,639,652 effective search space used: 3794526552 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -