BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_A19 (822 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ850291-1|CAH64511.1| 533|Tribolium castaneum putative esteras... 23 3.9 AJ850290-1|CAH64510.1| 533|Tribolium castaneum putative esteras... 23 3.9 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 22 6.8 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 22 6.8 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 22 6.8 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 22 6.8 >AJ850291-1|CAH64511.1| 533|Tribolium castaneum putative esterase protein. Length = 533 Score = 22.6 bits (46), Expect = 3.9 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -1 Query: 720 NFTNKAFFSLH 688 NF NKAFF H Sbjct: 20 NFNNKAFFCFH 30 >AJ850290-1|CAH64510.1| 533|Tribolium castaneum putative esterase protein. Length = 533 Score = 22.6 bits (46), Expect = 3.9 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -1 Query: 720 NFTNKAFFSLH 688 NF NKAFF H Sbjct: 20 NFNNKAFFCFH 30 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.8 bits (44), Expect = 6.8 Identities = 15/57 (26%), Positives = 25/57 (43%), Gaps = 4/57 (7%) Frame = -1 Query: 441 DNTGAADNFPCLAILVNLAETSPFSKLFVVV----NLDKWNLMFVAQSLNKFLVCSF 283 + +G+ N CL I V + + + FV+V + K L+F+ L V F Sbjct: 52 EESGSMANQKCLEITVKILKIVAYLVTFVIVLGSGVISKGTLLFMTSQLKPDKVTVF 108 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.8 bits (44), Expect = 6.8 Identities = 15/57 (26%), Positives = 25/57 (43%), Gaps = 4/57 (7%) Frame = -1 Query: 441 DNTGAADNFPCLAILVNLAETSPFSKLFVVV----NLDKWNLMFVAQSLNKFLVCSF 283 + +G+ N CL I V + + + FV+V + K L+F+ L V F Sbjct: 52 EESGSMANQKCLEITVKILKIVAYLVTFVIVLGSGVISKGTLLFMTSQLKPDKVTVF 108 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.8 bits (44), Expect = 6.8 Identities = 15/57 (26%), Positives = 25/57 (43%), Gaps = 4/57 (7%) Frame = -1 Query: 441 DNTGAADNFPCLAILVNLAETSPFSKLFVVV----NLDKWNLMFVAQSLNKFLVCSF 283 + +G+ N CL I V + + + FV+V + K L+F+ L V F Sbjct: 52 EESGSMANQKCLEITVKILKIVAYLVTFVIVLGSGVISKGTLLFMTSQLKPDKVTVF 108 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.8 bits (44), Expect = 6.8 Identities = 15/57 (26%), Positives = 25/57 (43%), Gaps = 4/57 (7%) Frame = -1 Query: 441 DNTGAADNFPCLAILVNLAETSPFSKLFVVV----NLDKWNLMFVAQSLNKFLVCSF 283 + +G+ N CL I V + + + FV+V + K L+F+ L V F Sbjct: 52 EESGSMANQKCLEITVKILKIVAYLVTFVIVLGSGVISKGTLLFMTSQLKPDKVTVF 108 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 147,138 Number of Sequences: 336 Number of extensions: 2350 Number of successful extensions: 10 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 22517873 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -