BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_A17 (861 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 23 4.1 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 7.2 AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esteras... 22 7.2 AJ845188-1|CAH60165.1| 517|Tribolium castaneum putative esteras... 22 7.2 AJ845187-1|CAH60164.1| 515|Tribolium castaneum esterase protein. 22 7.2 AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. 22 7.2 DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired pr... 21 9.5 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 22.6 bits (46), Expect = 4.1 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = -3 Query: 388 SXTFQTPLKDFFCF*LLGLYNGQQSFHY 305 S + PL D LL Y+ QQS HY Sbjct: 773 SVDYTKPLVDAQTMNLLRSYHQQQSHHY 800 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.8 bits (44), Expect = 7.2 Identities = 6/15 (40%), Positives = 9/15 (60%) Frame = -3 Query: 226 WRHESACHPDSPTQM 182 W + CHPD+ + M Sbjct: 2278 WPENTECHPDASSTM 2292 >AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esterase protein. Length = 515 Score = 21.8 bits (44), Expect = 7.2 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = -3 Query: 208 CHPDSPTQMFKAKLS-DMKIPHLHF*NILRTFFSFLSFFNAGG 83 CH D +FK KLS ++K L ++ R F F + F G Sbjct: 422 CHGDDIGYLFKTKLSPELKAGSLEEISVKR-FVKFWTNFARNG 463 >AJ845188-1|CAH60165.1| 517|Tribolium castaneum putative esterase protein. Length = 517 Score = 21.8 bits (44), Expect = 7.2 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = -3 Query: 208 CHPDSPTQMFKAKLS-DMKIPHLHF*NILRTFFSFLSFFNAGG 83 CH D +FK KLS ++K L ++ R F F + F G Sbjct: 424 CHGDDIGYLFKTKLSPELKAGSLEEISVKR-FVKFWTNFARNG 465 >AJ845187-1|CAH60164.1| 515|Tribolium castaneum esterase protein. Length = 515 Score = 21.8 bits (44), Expect = 7.2 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = -3 Query: 208 CHPDSPTQMFKAKLS-DMKIPHLHF*NILRTFFSFLSFFNAGG 83 CH D +FK KLS ++K L ++ R F F + F G Sbjct: 422 CHGDDIGYLFKTKLSPELKTGSLEEISVKR-FVKFWTNFARNG 463 >AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. Length = 517 Score = 21.8 bits (44), Expect = 7.2 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = -3 Query: 208 CHPDSPTQMFKAKLS-DMKIPHLHF*NILRTFFSFLSFFNAGG 83 CH D +FK KLS ++K L ++ R F F + F G Sbjct: 424 CHGDDIGYLFKTKLSPELKTGSLEEISVKR-FVKFWTNFARNG 465 >DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired protein. Length = 311 Score = 21.4 bits (43), Expect = 9.5 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -3 Query: 241 VLQHPWRHESACHPDSPTQMFK 176 VLQ P S+ P SP +FK Sbjct: 281 VLQSPSSTSSSPEPRSPESLFK 302 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 158,238 Number of Sequences: 336 Number of extensions: 3030 Number of successful extensions: 9 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23866870 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -