BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_A16 (881 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC651.06 |mug166||sequence orphan|Schizosaccharomyces pombe|ch... 28 2.0 SPBC2D10.18 |abc1|coq8|ABC1 kinase family protein|Schizosaccharo... 27 2.7 SPAC17H9.01 |cid16||poly|Schizosaccharomyces pombe|chr 1|||Manual 27 2.7 SPAC13A11.05 |||peptidase family M17|Schizosaccharomyces pombe|c... 26 6.2 SPAP8A3.14c |||mitochondrial inner membrane protein |Schizosacch... 26 8.2 SPAC13F5.06c |sec10||exocyst complex subunit Sec10|Schizosacchar... 26 8.2 >SPBC651.06 |mug166||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 234 Score = 27.9 bits (59), Expect = 2.0 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = -1 Query: 227 LQYPDRHFPSCMSLYSRQQRTVQNTARRNPSSLNYS 120 L PDRH PS S + + T + RN SL YS Sbjct: 162 LPAPDRHTPSSASSRASETGTTSPQSMRNQISLLYS 197 >SPBC2D10.18 |abc1|coq8|ABC1 kinase family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 610 Score = 27.5 bits (58), Expect = 2.7 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +2 Query: 104 PNQIGDYNSKMKGFYVLCFALFAAVYCKETYS 199 P + + ++ G ++LC L A V CKE +S Sbjct: 571 PEETYSLHRRLSGHFLLCAKLGAKVRCKELFS 602 >SPAC17H9.01 |cid16||poly|Schizosaccharomyces pombe|chr 1|||Manual Length = 1202 Score = 27.5 bits (58), Expect = 2.7 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Frame = +2 Query: 365 AQKHLFKRFLEVVRTATSEYEAFKLNTIP-XESISMLCYPPSLILRKSI 508 AQKH R ++ + TS + KL TIP E+ +LI RK+I Sbjct: 310 AQKHAINRISKLGKMITSNHAEEKLTTIPITEAKKESVSNTALIARKNI 358 >SPAC13A11.05 |||peptidase family M17|Schizosaccharomyces pombe|chr 1|||Manual Length = 513 Score = 26.2 bits (55), Expect = 6.2 Identities = 15/38 (39%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = +2 Query: 167 FAAVYCKETYSSENDDL-DIEALVGNIDSLKAFIGCFL 277 F Y K+ SS N DL ++ G + AFI CFL Sbjct: 433 FHEAYLKQLTSSSNADLCNVSRAGGGCCTAAAFIKCFL 470 >SPAP8A3.14c |||mitochondrial inner membrane protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 677 Score = 25.8 bits (54), Expect = 8.2 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = -1 Query: 215 DRHFPSCMSLYSRQQRTVQNTARRNPSSL-NYSLQFDSEDLFY 90 D C+S +SR + T + + L N+SL+ DS D FY Sbjct: 563 DAFLDDCVSFFSRPEMTQDSQLNASSGFLTNFSLK-DSTDRFY 604 >SPAC13F5.06c |sec10||exocyst complex subunit Sec10|Schizosaccharomyces pombe|chr 1|||Manual Length = 811 Score = 25.8 bits (54), Expect = 8.2 Identities = 18/80 (22%), Positives = 35/80 (43%), Gaps = 1/80 (1%) Frame = +2 Query: 167 FAAVYCKETYSSENDDLDIEALVGNID-SLKAFIGCFLETSPCDAVSGGFQKDIPEAVAE 343 F + + Y ++ND + +ID S+K+F C E + + G +D A + Sbjct: 29 FVEKFAESLYETQNDG---SKKLSSIDGSIKSFAACLHELNRLKSRVGDRIRDYASASKQ 85 Query: 344 ACGKCTPAQKHLFKRFLEVV 403 + HL ++F +V+ Sbjct: 86 VQNEYHQKSNHLREKFAQVL 105 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,647,165 Number of Sequences: 5004 Number of extensions: 50039 Number of successful extensions: 154 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 150 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 154 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 442483990 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -