BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_A16 (881 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_03_0084 + 8266564-8266699,8267497-8267685,8267772-8267911,826... 28 8.6 >05_03_0084 + 8266564-8266699,8267497-8267685,8267772-8267911, 8268130-8268225,8268327-8268388,8268559-8268634, 8268709-8268785,8268866-8268899,8268983-8269132, 8269222-8269356,8269450-8269533 Length = 392 Score = 28.3 bits (60), Expect = 8.6 Identities = 21/56 (37%), Positives = 27/56 (48%), Gaps = 6/56 (10%) Frame = +2 Query: 362 PAQKHLFKRFL---EVVRTATSEYEAFKLNTIPXESI---SMLCYPPSLILRKSIF 511 P K +RFL +V A + F N I S+ S++CY PSLI SIF Sbjct: 252 PTTKCFLRRFLRAAQVCHEAPVLHLEFLANYIAELSLLEYSLICYVPSLIAASSIF 307 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,871,948 Number of Sequences: 37544 Number of extensions: 310185 Number of successful extensions: 706 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 694 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 705 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2491484208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -