BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_A15 (887 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein p... 29 0.25 AB090818-1|BAC57911.1| 285|Anopheles gambiae gag-like protein p... 28 0.44 AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase pr... 25 2.3 AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 25 4.1 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 24 7.1 AY645021-1|AAT92557.1| 163|Anopheles gambiae even-skipped protein. 24 7.1 AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T... 24 7.1 AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. 23 9.4 >AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein protein. Length = 724 Score = 28.7 bits (61), Expect = 0.25 Identities = 18/51 (35%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Frame = +1 Query: 421 QAHKQKGPSRPQVDRPTKPQQNCIR*LQRQNQQESLLEVYPRVGKQ-QSLL 570 Q +Q+ RPQ RP + + R QR+ + L+EV P G+ +SLL Sbjct: 463 QQPQQQQQQRPQQQRPQQQRPQQQRSQQRKPAKPELIEVSPNEGQDWESLL 513 Score = 23.4 bits (48), Expect = 9.4 Identities = 17/58 (29%), Positives = 25/58 (43%) Frame = +1 Query: 421 QAHKQKGPSRPQVDRPTKPQQNCIR*LQRQNQQESLLEVYPRVGKQQSLLQDHVHRGQ 594 Q +Q+ R Q R + QQ QRQ QQ+ + + +QQ Q H+ Q Sbjct: 313 QQQQQQQQQRQQQQRQQQRQQQ-----QRQQQQQQQQQQRQQQQRQQQQQQQQQHQQQ 365 >AB090818-1|BAC57911.1| 285|Anopheles gambiae gag-like protein protein. Length = 285 Score = 27.9 bits (59), Expect = 0.44 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = +2 Query: 143 LTPHLHQELMTYWRSSCI*VSSLVNTRPLSPN 238 L P HQE MT WR + RP +P+ Sbjct: 100 LAPMSHQETMTLWREVAAALDGKAKCRPRTPS 131 >AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase protein. Length = 1253 Score = 25.4 bits (53), Expect = 2.3 Identities = 8/14 (57%), Positives = 12/14 (85%) Frame = +3 Query: 765 MKIWPPTKTVKPWG 806 M+++PPTK V P+G Sbjct: 315 MRVYPPTKIVTPYG 328 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 24.6 bits (51), Expect = 4.1 Identities = 15/48 (31%), Positives = 22/48 (45%) Frame = +2 Query: 575 IMSTEDKQYLKLDNTKGSSDDRIIYGDSTADTFKHHWYLEPSMYESDV 718 +M+ +D +D T G SDD GD T + PS+ ES + Sbjct: 971 VMAGDDMMMESVDLTIGGSDDGSFAGDKTHSASPNR-LESPSLNESSL 1017 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 23.8 bits (49), Expect = 7.1 Identities = 13/43 (30%), Positives = 20/43 (46%), Gaps = 3/43 (6%) Frame = -3 Query: 222 LVFTNDDTHIQLLR---QYVISSWCKCGVRSQRTHGEDEGKQS 103 LV N+ +QL +++S+WC + TH D K S Sbjct: 1408 LVNLNNQKRVQLTGAKVHHIMSNWCYAEMTIDTTHTADGSKLS 1450 >AY645021-1|AAT92557.1| 163|Anopheles gambiae even-skipped protein. Length = 163 Score = 23.8 bits (49), Expect = 7.1 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = -1 Query: 227 AVSYSPMTTLIYSCSASTSSVLGASVA 147 A+S SP++ + SASTS+ ASV+ Sbjct: 87 ALSLSPVSVSKFDTSASTSNSSNASVS 113 >AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1978 Score = 23.8 bits (49), Expect = 7.1 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +2 Query: 575 IMSTEDKQYLKLDNTKGSSDDRIIYGDST 661 +M+ +D +D T G SDD GD T Sbjct: 969 VMAGDDMMMESVDLTIGGSDDGSFAGDKT 997 >AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. Length = 1229 Score = 23.4 bits (48), Expect = 9.4 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +1 Query: 193 YMSVVIGEYETAIAKCSEYLKEKKGEV 273 YM +I + E +C + LKEK +V Sbjct: 550 YMEAIIVDTEKTARRCIQILKEKMLDV 576 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 895,505 Number of Sequences: 2352 Number of extensions: 19577 Number of successful extensions: 63 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 52 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 63 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 95507181 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -