BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_A14 (945 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U41994-2|AAO38634.1| 154|Caenorhabditis elegans Rnase h protein... 33 0.39 U41994-1|AAO91711.1| 155|Caenorhabditis elegans Rnase h protein... 33 0.39 U58086-1|AAC47123.1| 803|Caenorhabditis elegans CUL-4 protein. 30 2.8 U29536-1|AAA68791.3| 840|Caenorhabditis elegans Cullin protein ... 30 2.8 AC024810-3|AAU20831.1| 660|Caenorhabditis elegans Vasa- and bel... 30 2.8 AC024810-2|AAK68520.1| 644|Caenorhabditis elegans Vasa- and bel... 30 2.8 AC024810-1|AAF60764.1| 641|Caenorhabditis elegans Vasa- and bel... 30 2.8 >U41994-2|AAO38634.1| 154|Caenorhabditis elegans Rnase h protein 1.0, isoform b protein. Length = 154 Score = 32.7 bits (71), Expect = 0.39 Identities = 25/84 (29%), Positives = 42/84 (50%) Frame = +2 Query: 188 KQKKILSFFQDVSQLNTDDEYYKIGKDYDIEMNMDNYTNKKAVEEFLKMYRTGFMPKNLE 367 K KK+ S F + +T D YY + + + + + +TN V+E +K Y P + + Sbjct: 51 KPKKVESTFPE----STHDTYYAVARGHSVGV----FTNYNEVKEHIKNYP---QPLHKK 99 Query: 368 FSVFYDKMRDEAIALFHLFYYAKD 439 +S +EAIA FH +Y K+ Sbjct: 100 WSTL-----EEAIAYFHKYYEGKE 118 >U41994-1|AAO91711.1| 155|Caenorhabditis elegans Rnase h protein 1.0, isoform a protein. Length = 155 Score = 32.7 bits (71), Expect = 0.39 Identities = 25/84 (29%), Positives = 42/84 (50%) Frame = +2 Query: 188 KQKKILSFFQDVSQLNTDDEYYKIGKDYDIEMNMDNYTNKKAVEEFLKMYRTGFMPKNLE 367 K KK+ S F + +T D YY + + + + + +TN V+E +K Y P + + Sbjct: 51 KPKKVESTFPE----STHDTYYAVARGHSVGV----FTNYNEVKEHIKNYP---QPLHKK 99 Query: 368 FSVFYDKMRDEAIALFHLFYYAKD 439 +S +EAIA FH +Y K+ Sbjct: 100 WSTL-----EEAIAYFHKYYEGKE 118 >U58086-1|AAC47123.1| 803|Caenorhabditis elegans CUL-4 protein. Length = 803 Score = 29.9 bits (64), Expect = 2.8 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = +2 Query: 356 KNLEFSVFYDKMRDEAIALFHLFYYAKDFETFYKTACFARVHLNQ 490 KN+ D+M DEAI LF FE +YK R+ L + Sbjct: 455 KNVSDDTTLDQMVDEAIVLFRYLRGKDVFEAYYKRGLAKRLFLER 499 >U29536-1|AAA68791.3| 840|Caenorhabditis elegans Cullin protein 4 protein. Length = 840 Score = 29.9 bits (64), Expect = 2.8 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = +2 Query: 356 KNLEFSVFYDKMRDEAIALFHLFYYAKDFETFYKTACFARVHLNQ 490 KN+ D+M DEAI LF FE +YK R+ L + Sbjct: 492 KNVSDDTTLDQMVDEAIVLFRYLRGKDVFEAYYKRGLAKRLFLER 536 >AC024810-3|AAU20831.1| 660|Caenorhabditis elegans Vasa- and belle-like helicase protein1, isoform c protein. Length = 660 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +3 Query: 642 LINPEAAAKYGIHKENDYFVYKANYSNAVLYXNEE 746 +++P IHKE F YK+N A+LY E Sbjct: 227 VLSPTRELAIQIHKEATKFSYKSNIQTAILYGGRE 261 >AC024810-2|AAK68520.1| 644|Caenorhabditis elegans Vasa- and belle-like helicase protein1, isoform b protein. Length = 644 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +3 Query: 642 LINPEAAAKYGIHKENDYFVYKANYSNAVLYXNEE 746 +++P IHKE F YK+N A+LY E Sbjct: 211 VLSPTRELAIQIHKEATKFSYKSNIQTAILYGGRE 245 >AC024810-1|AAF60764.1| 641|Caenorhabditis elegans Vasa- and belle-like helicase protein1, isoform a protein. Length = 641 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +3 Query: 642 LINPEAAAKYGIHKENDYFVYKANYSNAVLYXNEE 746 +++P IHKE F YK+N A+LY E Sbjct: 208 VLSPTRELAIQIHKEATKFSYKSNIQTAILYGGRE 242 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,533,953 Number of Sequences: 27780 Number of extensions: 334782 Number of successful extensions: 908 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 866 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 908 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2444174194 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -