BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_A12 (896 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 54 2e-09 AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 44 2e-06 X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 22 5.7 AM292373-1|CAL23185.2| 360|Tribolium castaneum gustatory recept... 21 9.9 AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory recept... 21 9.9 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 54.0 bits (124), Expect = 2e-09 Identities = 29/87 (33%), Positives = 45/87 (51%) Frame = +2 Query: 347 LPRGETFVHTNELQMEEAVKVFRVLYYAKDFDVFMRTACWMRERINGGMFVYAFTAACFH 526 L R E F + A K+ R+ A+ D + A + R+R+N +F YAF+ A H Sbjct: 74 LGRHENFSLFIPKHRKVAGKLIRIFLAAESIDDLLSNAVFCRDRVNPYLFYYAFSVALLH 133 Query: 527 RTDCKGLYLPAPYEIYPYFFVDSHVIS 607 R D + L LP+ ++P +VDS V + Sbjct: 134 RPDTQNLDLPSFIHVFPDKYVDSQVFA 160 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 43.6 bits (98), Expect = 2e-06 Identities = 20/59 (33%), Positives = 34/59 (57%) Frame = +2 Query: 431 KDFDVFMRTACWMRERINGGMFVYAFTAACFHRTDCKGLYLPAPYEIYPYFFVDSHVIS 607 ++ D + A + R+R+N +F YA + A HR D + + LP+ E +P +VDS V + Sbjct: 102 RNVDDLLSVAVYARDRVNPYLFSYALSVAILHRQDTQDIDLPSFIESFPDKYVDSKVFA 160 Score = 25.0 bits (52), Expect = 0.80 Identities = 11/41 (26%), Positives = 18/41 (43%) Frame = +2 Query: 248 KEIAKEYNIEKSCDKYMNVDVVKQFMEMYKMGMLPRGETFV 370 ++I YN E+ C+K F E K P+ ++ V Sbjct: 237 QQIIARYNFERLCNKLKRATRFNDFNEAIKEAYFPKLDSLV 277 Score = 25.0 bits (52), Expect = 0.80 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -2 Query: 664 YXPEDRVLGGFSHLHHKGFTDDMAVNEE 581 + P V F+HL H+ FT + VN + Sbjct: 464 FQPRGSVFVRFTHLQHQPFTYKITVNNQ 491 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 22.2 bits (45), Expect = 5.7 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = -2 Query: 499 DEHASVDPFSHPARSPHENIEVLSVVEDSEDFDGFF 392 D ++ P + P R P +N + L +E S + G F Sbjct: 125 DMETTLTPCASPNRKPDDNQDHLRRLEMSLEKSGLF 160 >AM292373-1|CAL23185.2| 360|Tribolium castaneum gustatory receptor candidate 52 protein. Length = 360 Score = 21.4 bits (43), Expect = 9.9 Identities = 8/26 (30%), Positives = 15/26 (57%) Frame = -3 Query: 336 LYISMNCLTTSTFMYLSQLFSMLYSL 259 L+++ NC S Y+S +F+ + L Sbjct: 117 LFVASNCFFWSYQSYMSYIFANIMGL 142 >AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory receptor candidate 32 protein. Length = 651 Score = 21.4 bits (43), Expect = 9.9 Identities = 8/26 (30%), Positives = 15/26 (57%) Frame = -3 Query: 336 LYISMNCLTTSTFMYLSQLFSMLYSL 259 L+++ NC S Y+S +F+ + L Sbjct: 117 LFVASNCFFWSYQSYMSYIFANIMGL 142 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 186,592 Number of Sequences: 336 Number of extensions: 3686 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 24927353 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -