BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_A08 (888 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF098986-1|AAC67425.1| 747|Caenorhabditis elegans T box family ... 29 3.4 Z68338-7|CAA92756.2| 866|Caenorhabditis elegans Hypothetical pr... 29 4.4 U41039-3|AAK68627.2| 537|Caenorhabditis elegans Synapse defecti... 28 7.8 >AF098986-1|AAC67425.1| 747|Caenorhabditis elegans T box family protein 31 protein. Length = 747 Score = 29.5 bits (63), Expect = 3.4 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = -2 Query: 383 YILKLTSRLNNTSIYGVRFKDHFPIALAEPRTSIAGPALTMP 258 ++L L+ L S Y + K HFP TS+ GPA+ +P Sbjct: 612 HLLNLSHHLCRFSEYNLFVKAHFPRGSYGSLTSMTGPAVEIP 653 >Z68338-7|CAA92756.2| 866|Caenorhabditis elegans Hypothetical protein T24B8.4 protein. Length = 866 Score = 29.1 bits (62), Expect = 4.4 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = -1 Query: 729 PXXNXFFPXXXXXGGXPXXXKXFFXXGAXXPPXKGGXPXP 610 P N F P GG P F PP GG P P Sbjct: 68 PVPNGFIPPPPGPGGIPPPPPMFAGGIPPPPPMMGGIPPP 107 >U41039-3|AAK68627.2| 537|Caenorhabditis elegans Synapse defective protein 9, isoformc protein. Length = 537 Score = 28.3 bits (60), Expect = 7.8 Identities = 17/46 (36%), Positives = 24/46 (52%) Frame = -3 Query: 178 KPAPERRRRIGSLRNSL*VYVNSNADVKTQAALY*SLDVQLSRIKS 41 KPAPE+ SL N L V N+ ++K Q A ++ L+ I S Sbjct: 407 KPAPEQPVNASSLHNELRVISNAICELKAQQAATPRVEQALTYIDS 452 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,372,904 Number of Sequences: 27780 Number of extensions: 251186 Number of successful extensions: 456 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 451 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 456 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2244863852 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -