BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_A07 (890 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1450.09c |||phospholipase |Schizosaccharomyces pombe|chr 3||... 26 6.3 SPAC17C9.06 |sam50||SAM complex subunit Sam50 |Schizosaccharomyc... 26 8.3 SPBC713.04c |||U3 snoRNP-associated protein Utp1|Schizosaccharom... 26 8.3 >SPCC1450.09c |||phospholipase |Schizosaccharomyces pombe|chr 3|||Manual Length = 633 Score = 26.2 bits (55), Expect = 6.3 Identities = 14/45 (31%), Positives = 21/45 (46%) Frame = -3 Query: 345 FSAILQPKEAGLELSCGELWCKVERNLRVXPFFEVAQSTVNTGVN 211 F +LQ K AG +S +LW + V P A +T ++ N Sbjct: 220 FEQVLQKKNAGFNVSITDLWGRALALKLVNPLTGGANTTFSSVTN 264 >SPAC17C9.06 |sam50||SAM complex subunit Sam50 |Schizosaccharomyces pombe|chr 1|||Manual Length = 475 Score = 25.8 bits (54), Expect = 8.3 Identities = 15/46 (32%), Positives = 23/46 (50%) Frame = +1 Query: 217 PCVNSRLCHLKKGXNAXVSFDFTPQFSTTKLKTGLFGLKNGAEIPF 354 PC+++ L + A +FT +TT+ G GL+ GA I F Sbjct: 429 PCISTGLGLVYATPAARFELNFTLPIATTEKDIGRKGLQFGAGIDF 474 >SPBC713.04c |||U3 snoRNP-associated protein Utp1|Schizosaccharomyces pombe|chr 2|||Manual Length = 854 Score = 25.8 bits (54), Expect = 8.3 Identities = 15/40 (37%), Positives = 18/40 (45%) Frame = -3 Query: 519 HIWLSLSSFQSFHLNSKFPVGSFFPICKXKV*GLSFAGFG 400 HIWL + F+ NSK +F P V G S FG Sbjct: 241 HIWL-IKERHYFNQNSKLRCAAFHPTSNLLVVGFSSGLFG 279 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,017,237 Number of Sequences: 5004 Number of extensions: 34428 Number of successful extensions: 70 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 69 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 70 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 448490560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -