BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_A07 (890 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_01_0019 + 403078-404211 29 3.8 06_03_1270 - 28867654-28868076,28868394-28868785,28869438-288695... 29 3.8 02_01_0055 + 410661-411380,411481-413733,414486-414875,414983-41... 28 8.7 >09_01_0019 + 403078-404211 Length = 377 Score = 29.5 bits (63), Expect = 3.8 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = -2 Query: 376 RQHCREHQKEFQRHSSTQRGRS 311 R+H R+ +K+ RH S+ RGRS Sbjct: 207 RKHSRDEEKKTSRHRSSSRGRS 228 >06_03_1270 - 28867654-28868076,28868394-28868785,28869438-28869588, 28869727-28869906 Length = 381 Score = 29.5 bits (63), Expect = 3.8 Identities = 20/55 (36%), Positives = 26/55 (47%) Frame = -3 Query: 522 QHIWLSLSSFQSFHLNSKFPVGSFFPICKXKV*GLSFAGFGGT*RESASVSIVES 358 Q WL +S Q N P +FF I +V GL + GF G +E + S V S Sbjct: 229 QLAWLRATS-QELQQNLHAPAFAFFHIPIPEVRGLWYTGFKGQYQEGVACSTVNS 282 >02_01_0055 + 410661-411380,411481-413733,414486-414875,414983-418153 Length = 2177 Score = 28.3 bits (60), Expect = 8.7 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +1 Query: 352 FDALYNADACTLTSCPTEAGKTQTLDF 432 F LYN D L + PT +GKT +F Sbjct: 1370 FTVLYNTDDSVLVAAPTGSGKTICAEF 1396 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,660,652 Number of Sequences: 37544 Number of extensions: 230751 Number of successful extensions: 529 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 519 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 529 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2506954360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -