BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_A07 (890 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g46110.1 68418.m05669 phosphate/triose-phosphate translocator... 29 5.5 At4g16640.1 68417.m02515 matrix metalloproteinase, putative meta... 28 7.2 At4g03890.1 68417.m00546 hypothetical protein contains Pfam prof... 28 7.2 >At5g46110.1 68418.m05669 phosphate/triose-phosphate translocator, putative identical to phosphate/triose-phosphate translocator precursor [Arabidopsis thaliana] gi|3983125|gb|AAC83815; similar to triose phosphate/phosphate translocator, chloroplast precursor (CTPT)[Cauliflower]{Brassica oleracea} SWISS-PROT:P52177 Length = 410 Score = 28.7 bits (61), Expect = 5.5 Identities = 20/76 (26%), Positives = 29/76 (38%) Frame = +2 Query: 47 LLRXXCXASACPXWLSPLGCXSLHFSAVVSLXSTSSPQGXVGXWXPARVLXTXSELTPVL 226 LLR P P+G FS S + P G +G L + +L P+L Sbjct: 6 LLRATANVVGIPKLRRPIGAIHRQFSTASSSSFSVKPIGGIG---EGANLISGRQLRPIL 62 Query: 227 TVDCATSKKGKTRRFL 274 +D + G+ R L Sbjct: 63 LLDSSAINGGEKREIL 78 >At4g16640.1 68417.m02515 matrix metalloproteinase, putative metalloproteinase [Arabidopsis thaliana] GI:3128477; contains InterPro accession IPR001818: Matrixin Length = 364 Score = 28.3 bits (60), Expect = 7.2 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +1 Query: 268 VSFDFTPQFSTTKLKTGLFGLKNGAEIPFDAL 363 VSF+ F+T LK G + +G +PFD + Sbjct: 199 VSFEEVDDFTTADLKIGFYAGDHGDGLPFDGV 230 >At4g03890.1 68417.m00546 hypothetical protein contains Pfam profile PF03384: Drosophila protein of unknown function, DUF287 Length = 301 Score = 28.3 bits (60), Expect = 7.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +1 Query: 337 GAEIPFDALYNADACTLTSCPTE 405 G EI F+ +YN D T T PTE Sbjct: 241 GREIRFEEVYNEDVQTRTKAPTE 263 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,853,198 Number of Sequences: 28952 Number of extensions: 187416 Number of successful extensions: 502 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 495 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 502 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2090971320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -