BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_A05 (1192 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC830.05c |epl1||histone acetyltransferase complex subunit Epl... 29 1.7 >SPCC830.05c |epl1||histone acetyltransferase complex subunit Epl1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 557 Score = 28.7 bits (61), Expect = 1.7 Identities = 21/60 (35%), Positives = 23/60 (38%) Frame = -3 Query: 326 EFFFGPNTRPITPXLAKGRPPPMNRGKTGRRGAFVRPPKTRALCTMPEAHLFDXPSAKQT 147 E P RPI A P P KT A RP TR + P L D SA+ T Sbjct: 311 ELLINPKRRPIEVKPAAPVPTPAPPVKTSPHPASYRPQPTRNVEVRPLLMLDDVQSAQIT 370 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,087,091 Number of Sequences: 5004 Number of extensions: 80194 Number of successful extensions: 178 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 168 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 178 length of database: 2,362,478 effective HSP length: 74 effective length of database: 1,992,182 effective search space used: 641482604 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -