BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_A05 (1192 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g11990.1 68418.m01402 proline-rich family protein contains pr... 29 6.0 >At5g11990.1 68418.m01402 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 181 Score = 29.1 bits (62), Expect = 6.0 Identities = 14/40 (35%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = +3 Query: 510 PPKGSNPGGLAQPESPPSNP--QRXQTRGRKNEPQEFMVF 623 PP +P G P S PS+P + Q++G++ P F F Sbjct: 108 PPPPLSPDGKGSPPSVPSSPPSPKGQSQGQQQPPYPFPYF 147 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,675,421 Number of Sequences: 28952 Number of extensions: 496786 Number of successful extensions: 1449 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1291 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1443 length of database: 12,070,560 effective HSP length: 83 effective length of database: 9,667,544 effective search space used: 3025941272 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -