BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_A03 (847 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g20450.1 68415.m02387 60S ribosomal protein L14 (RPL14A) 96 3e-20 At4g27090.1 68417.m03894 60S ribosomal protein L14 (RPL14B) ribo... 95 7e-20 At1g64530.1 68414.m07315 RWP-RK domain-containing protein simila... 30 1.7 At5g02840.2 68418.m00227 myb family transcription factor contain... 29 2.9 At5g02840.1 68418.m00226 myb family transcription factor contain... 29 2.9 At1g01520.1 68414.m00068 myb family transcription factor similar... 29 2.9 At5g15890.1 68418.m01859 expressed protein 29 5.1 At5g18470.1 68418.m02175 curculin-like (mannose-binding) lectin ... 28 6.8 At1g18540.1 68414.m02313 60S ribosomal protein L6 (RPL6A) simila... 28 6.8 At1g09770.1 68414.m01096 myb family transcription factor contain... 28 6.8 At2g03890.2 68415.m00352 phosphatidylinositol 3- and 4-kinase fa... 28 9.0 >At2g20450.1 68415.m02387 60S ribosomal protein L14 (RPL14A) Length = 134 Score = 95.9 bits (228), Expect = 3e-20 Identities = 51/119 (42%), Positives = 73/119 (61%) Frame = +3 Query: 90 MPFARYVEPGRVALVADGPLKGKLVSVVDVIDQTRALVDGPGSGVPRQQIRLNQLHLTKF 269 M F R+VE GRVALV G GKLV +VDV+DQ RALVD P + R Q+ L +L LT Sbjct: 1 MGFKRFVEIGRVALVNYGEDYGKLVVIVDVVDQNRALVDAP--DMERIQMNLKRLSLTDI 58 Query: 270 RLKYAFTAPTRLVRKAWTDAKLNEKWTESQWAQKLANKEKRAQMTDYDRFKLTAARVKR 446 + +++ +A A + KW +S W +KL +++RA + D+DRFK+ A++KR Sbjct: 59 VIDINRVPKKKVLIEAMEKADVKNKWEKSSWGRKLIVQKRRAALNDFDRFKIMLAKIKR 117 >At4g27090.1 68417.m03894 60S ribosomal protein L14 (RPL14B) ribosomal protein L14 - Human,PIR3:JC5954 Length = 134 Score = 94.7 bits (225), Expect = 7e-20 Identities = 50/119 (42%), Positives = 71/119 (59%) Frame = +3 Query: 90 MPFARYVEPGRVALVADGPLKGKLVSVVDVIDQTRALVDGPGSGVPRQQIRLNQLHLTKF 269 M F RYVE GRVALV G GKLV +VDV+DQ RALVD P + R Q+ +L LT Sbjct: 1 MGFKRYVEIGRVALVNYGEDHGKLVVIVDVVDQNRALVDAP--DMERIQMNFKRLSLTDI 58 Query: 270 RLKYAFTAPTRLVRKAWTDAKLNEKWTESQWAQKLANKEKRAQMTDYDRFKLTAARVKR 446 + + + +A A + KW +S W +KL +++RA + D+DRFK+ A++K+ Sbjct: 59 VIDINRVPKKKALIEAMEKADVKNKWEKSSWGRKLIVQKRRANLNDFDRFKIMLAKIKK 117 >At1g64530.1 68414.m07315 RWP-RK domain-containing protein similar to nodule inception protein [Lotus japonicus] GI:6448579; contains Pfam profile: PF02042 RWP-RK domain Length = 841 Score = 30.3 bits (65), Expect = 1.7 Identities = 38/149 (25%), Positives = 59/149 (39%), Gaps = 15/149 (10%) Frame = +3 Query: 93 PFARYVEPGRVALVADGP--LKGKLVSVVDVIDQTRALVDGPGSGVPRQQIRLNQLHLTK 266 P+ + P + L + P L ++ DV + R D GS R ++N + T+ Sbjct: 634 PWPHQIPPIDIQLAKNCPPTSTSPLSNLQDVKIENRDAEDSAGSSTSRASCKVNPICETR 693 Query: 267 FRLKYAFTAPTRLVRKAWTDAKLNEKWTESQWA----QKLANKE---------KRAQMTD 407 FRL P+R V A D+ + K + WA Q A+ K D Sbjct: 694 FRLPTHNQEPSRQV--ALDDSDSSSKNMTNFWAHLTCQDTASPTILQHKLVSIKATYRED 751 Query: 408 YDRFKLTAARVKRNRARTAVFKSLKVKAA 494 RFK++ V + V K LK++ A Sbjct: 752 IIRFKISPESVSITELKQQVAKRLKLETA 780 >At5g02840.2 68418.m00227 myb family transcription factor contains PFAM profile: PF00249 myb-like DNA binding domain Length = 293 Score = 29.5 bits (63), Expect = 2.9 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +3 Query: 291 APTRLVRKAWTDAKLNEKWTESQ 359 AP + VRKA+T K E WTE + Sbjct: 33 APEKKVRKAYTITKSRESWTEGE 55 >At5g02840.1 68418.m00226 myb family transcription factor contains PFAM profile: PF00249 myb-like DNA binding domain Length = 293 Score = 29.5 bits (63), Expect = 2.9 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +3 Query: 291 APTRLVRKAWTDAKLNEKWTESQ 359 AP + VRKA+T K E WTE + Sbjct: 33 APEKKVRKAYTITKSRESWTEGE 55 >At1g01520.1 68414.m00068 myb family transcription factor similar to myb-related protein GI:2505876 from [Arabidopsis thaliana] Length = 287 Score = 29.5 bits (63), Expect = 2.9 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +3 Query: 285 FTAPTRLVRKAWTDAKLNEKWTESQ 359 F PT+ VRK +T K E WTE + Sbjct: 44 FEDPTKKVRKPYTITKSRENWTEQE 68 >At5g15890.1 68418.m01859 expressed protein Length = 526 Score = 28.7 bits (61), Expect = 5.1 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = -1 Query: 214 PGPSTSARVWSITSTTLTNFPFKGPSATRATRP 116 P P T +VW+ TS T P +AT+P Sbjct: 286 PSPDTDFKVWNYTSYNFTLHVMWSPFLVKATKP 318 >At5g18470.1 68418.m02175 curculin-like (mannose-binding) lectin family protein contains Pfam profile: PF01453 lectin (probable mannose binding) Length = 413 Score = 28.3 bits (60), Expect = 6.8 Identities = 18/63 (28%), Positives = 26/63 (41%), Gaps = 2/63 (3%) Frame = +2 Query: 5 IXYDLTIGNS*DLLFESTFVCVKTL*ERHAFCTVRRTRACRPGSR--RSLKGKVSERGRR 178 + + L+ NS + ES+ C L A C + ACR GS +G + E Sbjct: 289 VTFSLSSNNSSTWISESSEPCKTDLKNSSAICITEKPTACRKGSEYFEPRRGYMMENNTG 348 Query: 179 Y*P 187 Y P Sbjct: 349 YYP 351 >At1g18540.1 68414.m02313 60S ribosomal protein L6 (RPL6A) similar to 60S ribosomal protein L6 GI:7208784 from [Cicer arietinum] Length = 233 Score = 28.3 bits (60), Expect = 6.8 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 2/53 (3%) Frame = +3 Query: 108 VEPGRVALVADGPLKGKLVSVVDVIDQTRALVDGPG--SGVPRQQIRLNQLHL 260 + PG V ++ G KGK V + + LV GP +GVP + R+NQ ++ Sbjct: 89 ITPGTVLIILAGRFKGKRVVFLKQLSSGLLLVTGPFKINGVPLR--RVNQAYV 139 >At1g09770.1 68414.m01096 myb family transcription factor contains Pfam profile: PF00249 myb-like DNA-binding domain Length = 844 Score = 28.3 bits (60), Expect = 6.8 Identities = 19/81 (23%), Positives = 37/81 (45%) Frame = +3 Query: 282 AFTAPTRLVRKAWTDAKLNEKWTESQWAQKLANKEKRAQMTDYDRFKLTAARVKRNRART 461 AF VRK + + + ++++ E+RA+ T + + + T + + Sbjct: 692 AFQEEMENVRKKMEEDEKKAEHMKAKYKTYTKGHERRAE-TVWTQIEATLKQAEIGGTEV 750 Query: 462 AVFKSLKVKAARAGTFGKKNI 524 FK+LK + A +F KKN+ Sbjct: 751 ECFKALKRQEEMAASFRKKNL 771 >At2g03890.2 68415.m00352 phosphatidylinositol 3- and 4-kinase family protein low similarity to phosphatidylinositol 4-kinase type-II beta [Homo sapiens] GI:20159767; contains Pfam profile PF00454: Phosphatidylinositol 3- and 4-kinase Length = 530 Score = 27.9 bits (59), Expect = 9.0 Identities = 17/60 (28%), Positives = 25/60 (41%) Frame = +3 Query: 240 RLNQLHLTKFRLKYAFTAPTRLVRKAWTDAKLNEKWTESQWAQKLANKEKRAQMTDYDRF 419 R + +H K RL+ A PT + D L + S + +E A + DY RF Sbjct: 64 RSDNVHTVKRRLQIALNFPTEESSLTYGDMVLTNDLSSSVRVGETGFREVAAYLLDYGRF 123 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,834,859 Number of Sequences: 28952 Number of extensions: 276680 Number of successful extensions: 738 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 691 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 736 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1960634400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -