BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_A01 (1371 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z46676-8|CAB60993.2| 388|Caenorhabditis elegans Hypothetical pr... 36 0.088 U24189-3|AAC47514.1| 398|Caenorhabditis elegans RRM-type RNA bi... 36 0.088 AL032652-4|CAB63398.1| 486|Caenorhabditis elegans Hypothetical ... 29 7.7 >Z46676-8|CAB60993.2| 388|Caenorhabditis elegans Hypothetical protein C08B11.5 protein. Length = 388 Score = 35.5 bits (78), Expect = 0.088 Identities = 19/58 (32%), Positives = 19/58 (32%) Frame = +1 Query: 673 PPPSRSXXXXXXTPXPXXXPHPSXSTXRSXXPPDSXTGPPSXXPXXXIXXPGMXPPXG 846 PPPS P P P P PP S GPP PGM P G Sbjct: 289 PPPSSGMWPPPPPPPPGRTPGPPGMPGMPPPPPPSRFGPPGMGGMPPPPPPGMRYPGG 346 Score = 30.3 bits (65), Expect = 3.3 Identities = 24/77 (31%), Positives = 25/77 (32%), Gaps = 5/77 (6%) Frame = +1 Query: 673 PPPSRSXXXXXXTPXPXXXPHPSXSTXRSXXPPDSXTGPPSXXP-----XXXIXXPGMXP 837 PPP S TP P P T R PP S PP P PGM P Sbjct: 264 PPPPPSV-----TPMPPPMPPTPGMTPRPPPPPSSGMWPPPPPPPPGRTPGPPGMPGMPP 318 Query: 838 PXGRXXXXXLHXXGLPP 888 P G+PP Sbjct: 319 PPPPSRFGPPGMGGMPP 335 >U24189-3|AAC47514.1| 398|Caenorhabditis elegans RRM-type RNA binding protein protein. Length = 398 Score = 35.5 bits (78), Expect = 0.088 Identities = 19/58 (32%), Positives = 19/58 (32%) Frame = +1 Query: 673 PPPSRSXXXXXXTPXPXXXPHPSXSTXRSXXPPDSXTGPPSXXPXXXIXXPGMXPPXG 846 PPPS P P P P PP S GPP PGM P G Sbjct: 299 PPPSSGMWPPPPPPPPGRTPGPPGMPGMPPPPPPSRFGPPGMGGMPPPPPPGMRYPGG 356 Score = 30.3 bits (65), Expect = 3.3 Identities = 24/77 (31%), Positives = 25/77 (32%), Gaps = 5/77 (6%) Frame = +1 Query: 673 PPPSRSXXXXXXTPXPXXXPHPSXSTXRSXXPPDSXTGPPSXXP-----XXXIXXPGMXP 837 PPP S TP P P T R PP S PP P PGM P Sbjct: 274 PPPPPSV-----TPMPPPMPPTPGMTPRPPPPPSSGMWPPPPPPPPGRTPGPPGMPGMPP 328 Query: 838 PXGRXXXXXLHXXGLPP 888 P G+PP Sbjct: 329 PPPPSRFGPPGMGGMPP 345 >AL032652-4|CAB63398.1| 486|Caenorhabditis elegans Hypothetical protein Y63D3A.5 protein. Length = 486 Score = 29.1 bits (62), Expect = 7.7 Identities = 16/55 (29%), Positives = 19/55 (34%), Gaps = 4/55 (7%) Frame = +1 Query: 652 PXXVEIXPPPSRSXXXXXXTPXPXXXPHPSXST----XRSXXPPDSXTGPPSXXP 804 P E PPP + P P H S S+ + PP GPP P Sbjct: 247 PPVQEFAPPPPQQQQQQFQAPPPPMASHSSISSTPVQQQGFAPPQQFGGPPPSGP 301 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,382,510 Number of Sequences: 27780 Number of extensions: 128957 Number of successful extensions: 265 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 176 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 233 length of database: 12,740,198 effective HSP length: 84 effective length of database: 10,406,678 effective search space used: 3871284216 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -