BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_P23 (911 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC051694-1|AAH51694.1| 677|Homo sapiens similar to KIAA1680 pro... 31 5.8 AB051467-1|BAB21771.1| 902|Homo sapiens KIAA1680 protein protein. 31 5.8 >BC051694-1|AAH51694.1| 677|Homo sapiens similar to KIAA1680 protein protein. Length = 677 Score = 31.1 bits (67), Expect = 5.8 Identities = 16/45 (35%), Positives = 25/45 (55%) Frame = -1 Query: 638 TNHXGSLLGVRRLVFCDRTPSRPYHRQKSGCSYPDPTHRSLMLSS 504 TN G RR +F RTPS +H +K +PT+++L +S+ Sbjct: 49 TNSSSGSTGKRRSIF--RTPSISFHHKKGSEPKQEPTNQNLSISN 91 >AB051467-1|BAB21771.1| 902|Homo sapiens KIAA1680 protein protein. Length = 902 Score = 31.1 bits (67), Expect = 5.8 Identities = 16/45 (35%), Positives = 25/45 (55%) Frame = -1 Query: 638 TNHXGSLLGVRRLVFCDRTPSRPYHRQKSGCSYPDPTHRSLMLSS 504 TN G RR +F RTPS +H +K +PT+++L +S+ Sbjct: 51 TNSSSGSTGKRRSIF--RTPSISFHHKKGSEPKQEPTNQNLSISN 93 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 107,201,739 Number of Sequences: 237096 Number of extensions: 2373615 Number of successful extensions: 4829 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4503 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4822 length of database: 76,859,062 effective HSP length: 90 effective length of database: 55,520,422 effective search space used: 11825849886 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -