BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_P22 (892 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U14732-1|AAC46491.1| 322|Tribolium castaneum fushi-tarazu protein. 22 5.6 AY043292-2|AAK96032.1| 290|Tribolium castaneum homeodomain tran... 22 5.6 EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-deca... 22 7.4 AF321227-1|AAK16421.1| 290|Tribolium castaneum Ftz protein. 21 9.8 >U14732-1|AAC46491.1| 322|Tribolium castaneum fushi-tarazu protein. Length = 322 Score = 22.2 bits (45), Expect = 5.6 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = -2 Query: 363 RRRSEPFEIACRDSVNLCYMTTHPLTVTLM 274 R + EP +CR S+N Y+ +VT M Sbjct: 48 RVKEEPIYESCRFSINQPYLNHFDNSVTPM 77 >AY043292-2|AAK96032.1| 290|Tribolium castaneum homeodomain transcription factor Fushitarazu protein. Length = 290 Score = 22.2 bits (45), Expect = 5.6 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = -2 Query: 363 RRRSEPFEIACRDSVNLCYMTTHPLTVTLM 274 R + EP +CR S+N Y+ +VT M Sbjct: 48 RVKEEPIYESCRFSINQPYLNHFDNSVTPM 77 >EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-decarboxylase protein. Length = 540 Score = 21.8 bits (44), Expect = 7.4 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = +2 Query: 431 VCWWADPASLRAQK 472 +C+W P SLR +K Sbjct: 459 ICFWYVPKSLRGRK 472 >AF321227-1|AAK16421.1| 290|Tribolium castaneum Ftz protein. Length = 290 Score = 21.4 bits (43), Expect = 9.8 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -2 Query: 357 RSEPFEIACRDSVNLCYMTTHPLTVTLM 274 + EP +CR S+N Y+ +VT M Sbjct: 50 KEEPIYESCRFSINQPYLNHFDNSVTPM 77 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 162,790 Number of Sequences: 336 Number of extensions: 3008 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 24720487 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -