BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_P21 (938 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855490-1|ABH88177.1| 133|Tribolium castaneum chemosensory pro... 27 0.21 EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-deca... 22 6.0 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 22 7.9 >DQ855490-1|ABH88177.1| 133|Tribolium castaneum chemosensory protein 4 protein. Length = 133 Score = 27.1 bits (57), Expect = 0.21 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +1 Query: 415 CGKCTPAPENIYSNVSLKVVXDKLPQXXXAFKTKYDPQG 531 C KC+ + S+ ++ + D P A + KYDP G Sbjct: 77 CSKCSEKQKE-GSDFIMRYLIDNKPDYWKALEAKYDPDG 114 >EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-decarboxylase protein. Length = 540 Score = 22.2 bits (45), Expect = 6.0 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +1 Query: 421 KCTPAPENIYSNVSLKVVXDKLP 489 KC P P IYS VS V + LP Sbjct: 36 KC-PKPAPIYSPVSKPVSFESLP 57 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 21.8 bits (44), Expect = 7.9 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +2 Query: 494 NXKPSKLNTIPKEKHSDAL*SAXR 565 N K ++ N +P+EK DAL + R Sbjct: 17 NLKNAEFNGLPEEKLLDALCQSFR 40 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 149,868 Number of Sequences: 336 Number of extensions: 2822 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 26375415 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -