BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_P21 (938 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014296-1939|AAF50073.2| 558|Drosophila melanogaster CG6175-PB... 29 7.0 >AE014296-1939|AAF50073.2| 558|Drosophila melanogaster CG6175-PB protein. Length = 558 Score = 29.5 bits (63), Expect = 7.0 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +3 Query: 87 VQSYRXIFPNQLGRLLNSKNEGVSYVAWWFLH 182 ++S R F + G++L+ +N GV Y WF + Sbjct: 110 IKSLRSSFHREHGKVLSGRNRGVIYQPMWFAY 141 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 28,776,189 Number of Sequences: 53049 Number of extensions: 515613 Number of successful extensions: 940 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 916 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 940 length of database: 24,988,368 effective HSP length: 85 effective length of database: 20,479,203 effective search space used: 4648779081 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -