BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_P15 (832 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcript... 27 0.70 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 25 2.8 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 25 2.8 AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha ... 25 3.7 AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcript... 25 3.7 >AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcriptase protein. Length = 1022 Score = 27.1 bits (57), Expect = 0.70 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = +2 Query: 218 TGTPRESAQRGWGKNXXHKEV 280 T +PR++A++GW HKE+ Sbjct: 213 TPSPRDNAKKGWKTTLYHKEL 233 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 25.0 bits (52), Expect = 2.8 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -3 Query: 404 FLPFAGSFRSFGAEIFQRRSQLYNG 330 +LP+ FR FG ++ + S LY G Sbjct: 2648 YLPYGQIFRRFGTDLDGQISYLYTG 2672 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 25.0 bits (52), Expect = 2.8 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -3 Query: 404 FLPFAGSFRSFGAEIFQRRSQLYNG 330 +LP+ FR FG ++ + S LY G Sbjct: 2658 YLPYGQIFRRFGTDLDGQISYLYTG 2682 >AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha 1 chain precursor protein. Length = 801 Score = 24.6 bits (51), Expect = 3.7 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = -3 Query: 437 LFKTTRVXKRSFLPFAGSFRSFGAEIFQRRSQLYN 333 L +TT V R F F+ + +FG +F+R+ Q Y+ Sbjct: 28 LVRTTDV--RQFWAFSNNNDNFGVGLFKRQEQEYS 60 >AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcriptase protein. Length = 1168 Score = 24.6 bits (51), Expect = 3.7 Identities = 12/38 (31%), Positives = 19/38 (50%), Gaps = 2/38 (5%) Frame = +2 Query: 146 YRSQEXTTKVLPTSRTGML--SSLVSTGTPRESAQRGW 253 ++ T P SR + SS++S PR+ + RGW Sbjct: 163 FKGNRADTNRFPPSRPDVTFASSVISRLDPRDDSARGW 200 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 631,385 Number of Sequences: 2352 Number of extensions: 10378 Number of successful extensions: 13 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 87651612 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -