BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_P15 (832 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. 24 2.0 DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated... 22 8.0 DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protei... 22 8.0 >AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. Length = 615 Score = 23.8 bits (49), Expect = 2.0 Identities = 14/45 (31%), Positives = 18/45 (40%) Frame = -2 Query: 141 CDPRTGHLRPALLTRFIXLPXLEXXPCTRDIESKIXXXPYSEXVM 7 C G L ALL F+ + PC R S+I Y V+ Sbjct: 30 CSASNGELFLALLNFFVATSPVIGEPCQRVHSSRIPDLSYDFIVV 74 >DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 391 Score = 21.8 bits (44), Expect = 8.0 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -1 Query: 250 SSLCTFPGGTCRYQRRKHARTACR 179 SS+ + T +Y R HA AC+ Sbjct: 94 SSVTLYRNKTVKYSARMHAIIACQ 117 >DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protein protein. Length = 424 Score = 21.8 bits (44), Expect = 8.0 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = -3 Query: 263 YSXPILFVHFPGGYLSIPATKACPY 189 YS L FP GY + A K+ Y Sbjct: 28 YSWKALEFAFPNGYAKLAAIKSGSY 52 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 174,571 Number of Sequences: 438 Number of extensions: 3314 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26581563 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -