BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_P13 (895 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g36390.1 68415.m04466 1,4-alpha-glucan branching enzyme / sta... 31 0.78 At3g19430.1 68416.m02464 late embryogenesis abundant protein-rel... 29 3.1 At1g67770.1 68414.m07733 RNA-binding protein, putative similar t... 29 5.5 >At2g36390.1 68415.m04466 1,4-alpha-glucan branching enzyme / starch branching enzyme class II (SBE2-1) nearly identical to starch branching enzyme class II [Arabidopsis thaliana] GI:619939 Length = 858 Score = 31.5 bits (68), Expect = 0.78 Identities = 14/34 (41%), Positives = 23/34 (67%), Gaps = 2/34 (5%) Frame = -3 Query: 248 MIFIHNFHWINAGGDFAIG-TVPAVF-LRVDSYN 153 ++F+ NFHW N+ D+ IG +VP + + +DS N Sbjct: 760 LLFVFNFHWTNSYSDYRIGCSVPGKYKIVLDSDN 793 >At3g19430.1 68416.m02464 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 559 Score = 29.5 bits (63), Expect = 3.1 Identities = 15/51 (29%), Positives = 16/51 (31%) Frame = +3 Query: 741 PVXSXXSXTPPXPPPXNAXFXXLXXPXPXXPPXXPXXXPXXXXXXXTXXPP 893 P S S TPP PP + P P P P P PP Sbjct: 86 PTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPP 136 Score = 29.5 bits (63), Expect = 3.1 Identities = 15/51 (29%), Positives = 16/51 (31%) Frame = +3 Query: 741 PVXSXXSXTPPXPPPXNAXFXXLXXPXPXXPPXXPXXXPXXXXXXXTXXPP 893 P S S TPP PP + P P P P P PP Sbjct: 104 PTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPP 154 Score = 27.9 bits (59), Expect = 9.6 Identities = 13/39 (33%), Positives = 14/39 (35%) Frame = +3 Query: 741 PVXSXXSXTPPXPPPXNAXFXXLXXPXPXXPPXXPXXXP 857 P S S TPP PP + P P P P P Sbjct: 122 PTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTP 160 >At1g67770.1 68414.m07733 RNA-binding protein, putative similar to terminal ear1 gb|AAC39463.1 Length = 527 Score = 28.7 bits (61), Expect = 5.5 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +3 Query: 768 PPXPPPXNAXFXXLXXPXPXXPPXXP 845 PP PPP F P P PP P Sbjct: 47 PPPPPPPPLYFSYFSLPPPPPPPHLP 72 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,870,679 Number of Sequences: 28952 Number of extensions: 199368 Number of successful extensions: 881 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 416 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 807 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2100696768 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -