BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_P09 (846 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC27.04 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||M... 27 4.4 SPAC22E12.09c |krp1|krp|kexin|Schizosaccharomyces pombe|chr 1|||... 26 5.8 >SPBC27.04 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 1052 Score = 26.6 bits (56), Expect = 4.4 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +3 Query: 630 KPPSCALLFRPXPXTXYLSXFLPFGKA 710 +PPS ++L P +LS F+ GKA Sbjct: 24 EPPSSSILINTRPVNPFLSTFVYVGKA 50 >SPAC22E12.09c |krp1|krp|kexin|Schizosaccharomyces pombe|chr 1|||Manual Length = 709 Score = 26.2 bits (55), Expect = 5.8 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +3 Query: 96 IDTLMSLDQPQLECSXKNCFYL*TFVMLFAFI 191 I T++ QP LE S + TF +LFAFI Sbjct: 651 IPTVLPPTQPVLEPSYREIVAFITFFLLFAFI 682 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,892,841 Number of Sequences: 5004 Number of extensions: 50204 Number of successful extensions: 113 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 110 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 113 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 418457710 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -