BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_P09 (846 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) 130 1e-30 SB_39266| Best HMM Match : DCX (HMM E-Value=9.4e-15) 128 6e-30 SB_8730| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_33595| Best HMM Match : No HMM Matches (HMM E-Value=.) 89 6e-18 SB_48113| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 7e-18 SB_17601| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 1e-17 SB_29737| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_21722| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_466| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_54556| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_54315| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_49553| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_45413| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_40025| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_37523| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_36248| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_33560| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_33172| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_30123| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_24881| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_13522| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_13466| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_12912| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_10334| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_8826| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_7776| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_6431| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_5711| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_5382| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_4800| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_1110| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_457| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_53281| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_39971| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_39623| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_39403| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_35631| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_32025| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_29245| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_26817| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_22420| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_2684| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) 83 4e-16 SB_29741| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 6e-16 SB_28260| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_46297| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_52189| Best HMM Match : DUF454 (HMM E-Value=5.7) 75 7e-14 SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 7e-14 SB_6221| Best HMM Match : DUF1289 (HMM E-Value=6) 74 2e-13 SB_33488| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_25122| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_10421| Best HMM Match : Guanylate_cyc (HMM E-Value=0) 49 5e-06 SB_12752| Best HMM Match : Borrelia_orfA (HMM E-Value=0.15) 48 7e-06 SB_8415| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_48334| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_55059| Best HMM Match : Orn_Arg_deC_N (HMM E-Value=0) 45 7e-05 SB_56553| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_56924| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_22764| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_13469| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_23824| Best HMM Match : RRM_1 (HMM E-Value=1.9e-19) 40 0.003 SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_59116| Best HMM Match : TPR_1 (HMM E-Value=6.7e-15) 40 0.003 SB_49132| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_1272| Best HMM Match : Ras (HMM E-Value=8.9e-08) 39 0.004 SB_59645| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_59194| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_58676| Best HMM Match : FUN14 (HMM E-Value=0.16) 38 0.008 SB_58639| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_58410| Best HMM Match : Umbravirus_LDM (HMM E-Value=5.8) 38 0.008 SB_57920| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_57210| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_56445| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_55179| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_55096| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_54894| Best HMM Match : RuvB_C (HMM E-Value=2.3) 38 0.008 SB_53915| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_53615| Best HMM Match : GETHR (HMM E-Value=5.3e-09) 38 0.008 SB_53012| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_52037| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_51499| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_50666| Best HMM Match : ig (HMM E-Value=2.8e-20) 38 0.008 SB_50584| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_50510| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_50269| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_50037| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_49291| Best HMM Match : Herpes_UL69 (HMM E-Value=4.5) 38 0.008 SB_49138| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_48746| Best HMM Match : fn3 (HMM E-Value=7.2) 38 0.008 SB_48519| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_47856| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 38 0.008 SB_47451| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_47049| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.69) 38 0.008 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 38 0.008 SB_45327| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_44738| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_42360| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_42151| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_42061| Best HMM Match : CcoS (HMM E-Value=1.5) 38 0.008 SB_41957| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_41059| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_40873| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_40612| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_40524| Best HMM Match : Ribosomal_S18 (HMM E-Value=2) 38 0.008 SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_39337| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_39248| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_38896| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_38748| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_38234| Best HMM Match : RuvB_C (HMM E-Value=7) 38 0.008 SB_38187| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_36515| Best HMM Match : UPF0126 (HMM E-Value=0.73) 38 0.008 SB_36183| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_35069| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_34721| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_34207| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_34127| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_34032| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-22) 38 0.008 SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) 38 0.008 SB_33167| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_33062| Best HMM Match : DUF485 (HMM E-Value=7.5) 38 0.008 SB_32555| Best HMM Match : RVT_1 (HMM E-Value=2e-35) 38 0.008 SB_32080| Best HMM Match : Plasmid_stabil (HMM E-Value=5.7) 38 0.008 SB_31947| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_31774| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_31098| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_31001| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_30603| Best HMM Match : PKD_channel (HMM E-Value=1.2e-15) 38 0.008 SB_30119| Best HMM Match : VWC (HMM E-Value=2.1) 38 0.008 SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_29430| Best HMM Match : AhpC-TSA (HMM E-Value=0.00012) 38 0.008 SB_29254| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_29238| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_27679| Best HMM Match : zf-MYND (HMM E-Value=0.00039) 38 0.008 SB_26979| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=0.017) 38 0.008 SB_26811| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_25376| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_24858| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_24766| Best HMM Match : Plasmid_stabil (HMM E-Value=7.3) 38 0.008 SB_24481| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_24446| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_23906| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_23492| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_23266| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_23148| Best HMM Match : DUF1491 (HMM E-Value=9.3) 38 0.008 SB_21952| Best HMM Match : Pertussis_S2S3 (HMM E-Value=3.2) 38 0.008 SB_21736| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_20088| Best HMM Match : OAD_gamma (HMM E-Value=3) 38 0.008 SB_19974| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_19756| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_19194| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_18781| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_18659| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_17152| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_16892| Best HMM Match : TIL (HMM E-Value=4.4) 38 0.008 SB_16821| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 38 0.008 SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_16131| Best HMM Match : RhoGEF (HMM E-Value=2e-05) 38 0.008 SB_15016| Best HMM Match : Peptidase_C9 (HMM E-Value=7.2) 38 0.008 SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) 38 0.008 SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) 38 0.008 SB_12755| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_12438| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_12289| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_11969| Best HMM Match : Papilloma_E5 (HMM E-Value=4.6) 38 0.008 SB_11820| Best HMM Match : EGF_2 (HMM E-Value=9.8) 38 0.008 SB_11146| Best HMM Match : K_tetra (HMM E-Value=1.1e-34) 38 0.008 SB_9574| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_9532| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_9470| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_8947| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_8444| Best HMM Match : BRE (HMM E-Value=6.4) 38 0.008 SB_8427| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_8359| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_7275| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_7053| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_6150| Best HMM Match : GAT (HMM E-Value=2.3e-34) 38 0.008 SB_5713| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_5443| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_5310| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_5128| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_4813| Best HMM Match : EMP24_GP25L (HMM E-Value=3.9e-13) 38 0.008 SB_4398| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) 38 0.008 SB_3825| Best HMM Match : Pheromone (HMM E-Value=3.3) 38 0.008 SB_3784| Best HMM Match : ICAM_N (HMM E-Value=4.1) 38 0.008 SB_3664| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_3135| Best HMM Match : KorB_C (HMM E-Value=2.8) 38 0.008 SB_2945| Best HMM Match : NADH_dehy_S2_C (HMM E-Value=4.4) 38 0.008 SB_2451| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_2317| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_1908| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_941| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_630| Best HMM Match : Pox_F17 (HMM E-Value=2.4) 38 0.008 SB_602| Best HMM Match : TSP_1 (HMM E-Value=1e-27) 38 0.008 SB_215| Best HMM Match : ALG3 (HMM E-Value=0.18) 38 0.008 SB_12| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_59622| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_59470| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_59436| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_59341| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_59321| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_59114| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_58497| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_58355| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_58133| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_58128| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_57986| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_57590| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_57559| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_57358| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_57221| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_56778| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_56683| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_56485| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_56405| Best HMM Match : Fels1 (HMM E-Value=6.5) 38 0.008 SB_56072| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_55971| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_55894| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_55772| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_55573| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_55215| Best HMM Match : Peptidase_A16_N (HMM E-Value=0.0003) 38 0.008 SB_55103| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_55047| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_54903| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_54851| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_54599| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_54482| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6) 38 0.008 SB_54325| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_53936| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_53836| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_53698| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_53493| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_53207| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_52948| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_52761| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_52662| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_52635| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=1.3) 38 0.008 SB_52572| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_52560| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_52557| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_51972| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_51882| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_51647| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_51566| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_51213| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_51064| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_50537| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_50527| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_50288| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_49986| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_49737| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_49720| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_49124| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_48785| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_48664| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_48482| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_47984| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_47738| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_47507| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_47297| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_47238| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_46711| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_46514| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) 38 0.008 SB_46282| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_46221| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_45973| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_45953| Best HMM Match : LRR_1 (HMM E-Value=7.4e-15) 38 0.008 SB_45744| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_45699| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_45621| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_45393| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.088) 38 0.008 SB_45253| Best HMM Match : ig (HMM E-Value=0.00016) 38 0.008 SB_45037| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_44899| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_44811| Best HMM Match : Toxin_33 (HMM E-Value=8.1) 38 0.008 SB_44593| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_44336| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_44213| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_44147| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_44009| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_44008| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_43854| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.7) 38 0.008 SB_43776| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_43277| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_43222| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_43062| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_43007| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_42249| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_42173| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_42028| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_41969| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_41303| Best HMM Match : DUF485 (HMM E-Value=2) 38 0.008 SB_40919| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_40898| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_40785| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_40759| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_40752| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.5) 38 0.008 SB_40658| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_40596| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_40501| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_40404| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_40215| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_40094| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_39735| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_39642| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_39544| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_39336| Best HMM Match : Kinesin (HMM E-Value=0) 38 0.008 SB_39320| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_39283| Best HMM Match : ADK (HMM E-Value=3.7) 38 0.008 SB_39131| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_39083| Best HMM Match : PhaC_N (HMM E-Value=0.7) 38 0.008 SB_39081| Best HMM Match : Pertussis_S2S3 (HMM E-Value=9.8) 38 0.008 SB_38904| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_38654| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_38368| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-15) 38 0.008 SB_38317| Best HMM Match : bZIP_2 (HMM E-Value=5.1e-14) 38 0.008 SB_38140| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_37833| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_37700| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_37689| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_37634| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_37586| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_37467| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_37442| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_37275| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_37260| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_37081| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_36845| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_36843| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_36822| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_36672| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_36551| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_36497| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_36480| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_36092| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_36066| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_36015| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_35911| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_35809| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_35778| Best HMM Match : Dickkopf_N (HMM E-Value=2.4) 38 0.008 SB_35695| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_35616| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_35502| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_35393| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_35230| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_35217| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_35048| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_34691| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) 38 0.008 SB_34399| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_34374| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_34337| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_34227| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_34125| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_34092| Best HMM Match : RuvB_C (HMM E-Value=3.6) 38 0.008 SB_33490| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_33325| Best HMM Match : ShTK (HMM E-Value=6.3e-10) 38 0.008 SB_33281| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_33205| Best HMM Match : Mucin (HMM E-Value=0.0024) 38 0.008 SB_32541| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_32443| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_32291| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_32217| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_32188| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_32162| Best HMM Match : Ras (HMM E-Value=4.7e-31) 38 0.008 SB_32050| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_31853| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_31524| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_31275| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_31071| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_30889| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_30687| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_30453| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_30166| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_30004| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_29812| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_29620| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_29583| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_29441| Best HMM Match : MFS_1 (HMM E-Value=1.6e-12) 38 0.008 SB_29433| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_29380| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_29161| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_29146| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_28829| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_28797| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_28439| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_28284| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_28002| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_27895| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) 38 0.008 SB_27625| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_27082| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_26894| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_26697| Best HMM Match : EGF (HMM E-Value=7.5e-34) 38 0.008 SB_26278| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_26034| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_26029| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_25779| Best HMM Match : DUF485 (HMM E-Value=5.1) 38 0.008 SB_25252| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_25111| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_24900| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_24899| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_24625| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_24609| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_24558| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_24394| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_24302| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_24239| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_23976| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_23972| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_23930| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_23315| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_23224| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_23079| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_23046| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_22871| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_22743| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_22715| Best HMM Match : SAM_PNT (HMM E-Value=1.8) 38 0.008 SB_22691| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_22298| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_22087| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_21944| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_21601| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4) 38 0.008 SB_21539| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_21220| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_21197| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_21163| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_21132| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_21115| Best HMM Match : Swi3 (HMM E-Value=6.9) 38 0.008 SB_20993| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_20955| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_20344| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_20082| Best HMM Match : DUF378 (HMM E-Value=4.1) 38 0.008 SB_20043| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_19841| Best HMM Match : Myb_DNA-binding (HMM E-Value=1.1) 38 0.008 SB_19497| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_19464| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_19432| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_19022| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_18824| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_18805| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_18801| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_18630| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_18572| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_18544| Best HMM Match : 7tm_1 (HMM E-Value=0.00082) 38 0.008 SB_18337| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_18037| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_17968| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_17922| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_17258| Best HMM Match : DUF791 (HMM E-Value=0.002) 38 0.008 SB_17135| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_16840| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_16777| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4) 38 0.008 SB_16764| Best HMM Match : ACPS (HMM E-Value=4.4) 38 0.008 SB_16696| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_16602| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_16512| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_16421| Best HMM Match : HD-ZIP_N (HMM E-Value=7.6) 38 0.008 SB_16384| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.1) 38 0.008 SB_16324| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_16112| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_16101| Best HMM Match : RVT_1 (HMM E-Value=0.00031) 38 0.008 SB_15857| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_15771| Best HMM Match : VQ (HMM E-Value=4.3) 38 0.008 SB_15715| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_15545| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_15218| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_15175| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_15145| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_14983| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_14808| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_14442| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_14379| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_14356| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_14291| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_13637| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_13233| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 >SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) Length = 271 Score = 130 bits (314), Expect = 1e-30 Identities = 82/143 (57%), Positives = 87/143 (60%), Gaps = 8/143 (5%) Frame = +2 Query: 440 NQGITQXRTCEQKASKRPXTVKSPRCWRFSIGSAPLTSIXKIDAQVRGGETRQXYKDTRR 619 NQGITQ RTCEQKASKRP TVK PRCWRFSIGSAPLTSI KIDAQVRGGETRQ YKDTRR Sbjct: 86 NQGITQERTCEQKASKRPGTVKRPRCWRFSIGSAPLTSITKIDAQVRGGETRQDYKDTRR 145 Query: 620 FPLETSLXRSPVPTLXXYRIPVXLSPF--RES--VALSH----SSRCRYLSSV*VVRSKL 775 FPLE S R+P PF RE+ ++H S RCR + V Sbjct: 146 FPLEAP---SCALLFRPCRLPDTCPPFSLREAWRFLIAHAVGISVRCRSFAPSWAV---- 198 Query: 776 GCVXEPPXSXXPLXLSGTIVLSP 844 C PP S TIVLSP Sbjct: 199 -CT-NPPFSPTAAPYPVTIVLSP 219 >SB_39266| Best HMM Match : DCX (HMM E-Value=9.4e-15) Length = 347 Score = 128 bits (309), Expect = 6e-30 Identities = 59/65 (90%), Positives = 60/65 (92%) Frame = +2 Query: 437 QNQGITQXRTCEQKASKRPXTVKSPRCWRFSIGSAPLTSIXKIDAQVRGGETRQXYKDTR 616 +NQGITQ RTCEQKASKRP TVK PRCWRFSIGSAPLTSI KIDAQVRGGETRQ YKDTR Sbjct: 114 KNQGITQERTCEQKASKRPGTVKRPRCWRFSIGSAPLTSITKIDAQVRGGETRQDYKDTR 173 Query: 617 RFPLE 631 RFPLE Sbjct: 174 RFPLE 178 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/50 (48%), Positives = 28/50 (56%) Frame = +3 Query: 624 PWKPPSCALLFRPXPXTXYLSXFLPFGKAWRFLIAHAVGISVRCRSFAPS 773 P + PSCALLFRP F +AWRFLIAHAV I ++F S Sbjct: 176 PLEAPSCALLFRPCRLPDTCPPF-SLREAWRFLIAHAVAIRTAKKTFQGS 224 >SB_8730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 91.1 bits (216), Expect = 1e-18 Identities = 44/60 (73%), Positives = 44/60 (73%) Frame = -3 Query: 556 DARQGGGAYGKTPATRAFYGXWPFAGLLLTCSXLRYXXXXXXXXXXXLSELIPLAAAERP 377 D QGGGAYGKTPATR FYG WPFAGLLLTCS LRY LSELIPLAAAERP Sbjct: 19 DVGQGGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERP 78 >SB_33595| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 901 Score = 88.6 bits (210), Expect = 6e-18 Identities = 42/58 (72%), Positives = 44/58 (75%) Frame = -3 Query: 550 RQGGGAYGKTPATRAFYGXWPFAGLLLTCSXLRYXXXXXXXXXXXLSELIPLAAAERP 377 ++GGGAYGKTPATR FYG WPFAGLLLTCS LRY LSELIPLAAAERP Sbjct: 757 KRGGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERP 814 >SB_48113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 466 Score = 88.2 bits (209), Expect = 7e-18 Identities = 42/57 (73%), Positives = 43/57 (75%) Frame = -3 Query: 547 QGGGAYGKTPATRAFYGXWPFAGLLLTCSXLRYXXXXXXXXXXXLSELIPLAAAERP 377 +GGGAYGKTPATR FYG WPFAGLLLTCS LRY LSELIPLAAAERP Sbjct: 405 EGGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERP 461 >SB_17601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 649 Score = 87.8 bits (208), Expect = 1e-17 Identities = 42/57 (73%), Positives = 43/57 (75%) Frame = -3 Query: 547 QGGGAYGKTPATRAFYGXWPFAGLLLTCSXLRYXXXXXXXXXXXLSELIPLAAAERP 377 +GGGAYGKTPATR FYG WPFAGLLLTCS LRY LSELIPLAAAERP Sbjct: 554 KGGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERP 610 >SB_29737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 87.4 bits (207), Expect = 1e-17 Identities = 42/56 (75%), Positives = 42/56 (75%) Frame = -3 Query: 544 GGGAYGKTPATRAFYGXWPFAGLLLTCSXLRYXXXXXXXXXXXLSELIPLAAAERP 377 GGGAYGKTPATR FYG WPFAGLLLTCS LRY LSELIPLAAAERP Sbjct: 1 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERP 56 >SB_21722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 284 Score = 87.4 bits (207), Expect = 1e-17 Identities = 42/56 (75%), Positives = 42/56 (75%) Frame = -3 Query: 544 GGGAYGKTPATRAFYGXWPFAGLLLTCSXLRYXXXXXXXXXXXLSELIPLAAAERP 377 GGGAYGKTPATR FYG WPFAGLLLTCS LRY LSELIPLAAAERP Sbjct: 24 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERP 79 >SB_466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 87.4 bits (207), Expect = 1e-17 Identities = 42/56 (75%), Positives = 42/56 (75%) Frame = -3 Query: 544 GGGAYGKTPATRAFYGXWPFAGLLLTCSXLRYXXXXXXXXXXXLSELIPLAAAERP 377 GGGAYGKTPATR FYG WPFAGLLLTCS LRY LSELIPLAAAERP Sbjct: 1 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERP 56 >SB_54556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 83.0 bits (196), Expect = 3e-16 Identities = 36/40 (90%), Positives = 36/40 (90%) Frame = -2 Query: 533 LWKNASNAGFLRXLAFCWPFAHMFFXALSPDSVDNXITAF 414 LWKNASNA FLR LAFCWPFAHMFF ALSPDSVDN ITAF Sbjct: 21 LWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_54315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 83.0 bits (196), Expect = 3e-16 Identities = 36/40 (90%), Positives = 36/40 (90%) Frame = -2 Query: 533 LWKNASNAGFLRXLAFCWPFAHMFFXALSPDSVDNXITAF 414 LWKNASNA FLR LAFCWPFAHMFF ALSPDSVDN ITAF Sbjct: 21 LWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_49553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 83.0 bits (196), Expect = 3e-16 Identities = 36/40 (90%), Positives = 36/40 (90%) Frame = -2 Query: 533 LWKNASNAGFLRXLAFCWPFAHMFFXALSPDSVDNXITAF 414 LWKNASNA FLR LAFCWPFAHMFF ALSPDSVDN ITAF Sbjct: 21 LWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 83.0 bits (196), Expect = 3e-16 Identities = 36/40 (90%), Positives = 36/40 (90%) Frame = -2 Query: 533 LWKNASNAGFLRXLAFCWPFAHMFFXALSPDSVDNXITAF 414 LWKNASNA FLR LAFCWPFAHMFF ALSPDSVDN ITAF Sbjct: 21 LWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_45413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 83.0 bits (196), Expect = 3e-16 Identities = 36/40 (90%), Positives = 36/40 (90%) Frame = -2 Query: 533 LWKNASNAGFLRXLAFCWPFAHMFFXALSPDSVDNXITAF 414 LWKNASNA FLR LAFCWPFAHMFF ALSPDSVDN ITAF Sbjct: 21 LWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_40025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 83.0 bits (196), Expect = 3e-16 Identities = 36/40 (90%), Positives = 36/40 (90%) Frame = -2 Query: 533 LWKNASNAGFLRXLAFCWPFAHMFFXALSPDSVDNXITAF 414 LWKNASNA FLR LAFCWPFAHMFF ALSPDSVDN ITAF Sbjct: 21 LWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_37523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 83.0 bits (196), Expect = 3e-16 Identities = 36/40 (90%), Positives = 36/40 (90%) Frame = -2 Query: 533 LWKNASNAGFLRXLAFCWPFAHMFFXALSPDSVDNXITAF 414 LWKNASNA FLR LAFCWPFAHMFF ALSPDSVDN ITAF Sbjct: 21 LWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_36248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 83.0 bits (196), Expect = 3e-16 Identities = 36/40 (90%), Positives = 36/40 (90%) Frame = -2 Query: 533 LWKNASNAGFLRXLAFCWPFAHMFFXALSPDSVDNXITAF 414 LWKNASNA FLR LAFCWPFAHMFF ALSPDSVDN ITAF Sbjct: 21 LWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_33560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 83.0 bits (196), Expect = 3e-16 Identities = 36/40 (90%), Positives = 36/40 (90%) Frame = -2 Query: 533 LWKNASNAGFLRXLAFCWPFAHMFFXALSPDSVDNXITAF 414 LWKNASNA FLR LAFCWPFAHMFF ALSPDSVDN ITAF Sbjct: 21 LWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_33172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 83.0 bits (196), Expect = 3e-16 Identities = 36/40 (90%), Positives = 36/40 (90%) Frame = -2 Query: 533 LWKNASNAGFLRXLAFCWPFAHMFFXALSPDSVDNXITAF 414 LWKNASNA FLR LAFCWPFAHMFF ALSPDSVDN ITAF Sbjct: 21 LWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_30123| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 83.0 bits (196), Expect = 3e-16 Identities = 36/40 (90%), Positives = 36/40 (90%) Frame = -2 Query: 533 LWKNASNAGFLRXLAFCWPFAHMFFXALSPDSVDNXITAF 414 LWKNASNA FLR LAFCWPFAHMFF ALSPDSVDN ITAF Sbjct: 21 LWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_24881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 83.0 bits (196), Expect = 3e-16 Identities = 36/40 (90%), Positives = 36/40 (90%) Frame = -2 Query: 533 LWKNASNAGFLRXLAFCWPFAHMFFXALSPDSVDNXITAF 414 LWKNASNA FLR LAFCWPFAHMFF ALSPDSVDN ITAF Sbjct: 21 LWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_13522| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 83.0 bits (196), Expect = 3e-16 Identities = 36/40 (90%), Positives = 36/40 (90%) Frame = -2 Query: 533 LWKNASNAGFLRXLAFCWPFAHMFFXALSPDSVDNXITAF 414 LWKNASNA FLR LAFCWPFAHMFF ALSPDSVDN ITAF Sbjct: 21 LWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_13466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 83.0 bits (196), Expect = 3e-16 Identities = 36/40 (90%), Positives = 36/40 (90%) Frame = -2 Query: 533 LWKNASNAGFLRXLAFCWPFAHMFFXALSPDSVDNXITAF 414 LWKNASNA FLR LAFCWPFAHMFF ALSPDSVDN ITAF Sbjct: 21 LWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_12912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 83.0 bits (196), Expect = 3e-16 Identities = 36/40 (90%), Positives = 36/40 (90%) Frame = -2 Query: 533 LWKNASNAGFLRXLAFCWPFAHMFFXALSPDSVDNXITAF 414 LWKNASNA FLR LAFCWPFAHMFF ALSPDSVDN ITAF Sbjct: 21 LWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_10334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 83.0 bits (196), Expect = 3e-16 Identities = 36/40 (90%), Positives = 36/40 (90%) Frame = -2 Query: 533 LWKNASNAGFLRXLAFCWPFAHMFFXALSPDSVDNXITAF 414 LWKNASNA FLR LAFCWPFAHMFF ALSPDSVDN ITAF Sbjct: 21 LWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_8826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 83.0 bits (196), Expect = 3e-16 Identities = 36/40 (90%), Positives = 36/40 (90%) Frame = -2 Query: 533 LWKNASNAGFLRXLAFCWPFAHMFFXALSPDSVDNXITAF 414 LWKNASNA FLR LAFCWPFAHMFF ALSPDSVDN ITAF Sbjct: 21 LWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_7776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 83.0 bits (196), Expect = 3e-16 Identities = 36/40 (90%), Positives = 36/40 (90%) Frame = -2 Query: 533 LWKNASNAGFLRXLAFCWPFAHMFFXALSPDSVDNXITAF 414 LWKNASNA FLR LAFCWPFAHMFF ALSPDSVDN ITAF Sbjct: 21 LWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_6431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 83.0 bits (196), Expect = 3e-16 Identities = 36/40 (90%), Positives = 36/40 (90%) Frame = -2 Query: 533 LWKNASNAGFLRXLAFCWPFAHMFFXALSPDSVDNXITAF 414 LWKNASNA FLR LAFCWPFAHMFF ALSPDSVDN ITAF Sbjct: 21 LWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_5711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 83.0 bits (196), Expect = 3e-16 Identities = 36/40 (90%), Positives = 36/40 (90%) Frame = -2 Query: 533 LWKNASNAGFLRXLAFCWPFAHMFFXALSPDSVDNXITAF 414 LWKNASNA FLR LAFCWPFAHMFF ALSPDSVDN ITAF Sbjct: 21 LWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_5382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 83.0 bits (196), Expect = 3e-16 Identities = 36/40 (90%), Positives = 36/40 (90%) Frame = -2 Query: 533 LWKNASNAGFLRXLAFCWPFAHMFFXALSPDSVDNXITAF 414 LWKNASNA FLR LAFCWPFAHMFF ALSPDSVDN ITAF Sbjct: 21 LWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_4800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 83.0 bits (196), Expect = 3e-16 Identities = 36/40 (90%), Positives = 36/40 (90%) Frame = -2 Query: 533 LWKNASNAGFLRXLAFCWPFAHMFFXALSPDSVDNXITAF 414 LWKNASNA FLR LAFCWPFAHMFF ALSPDSVDN ITAF Sbjct: 21 LWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_1110| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 83.0 bits (196), Expect = 3e-16 Identities = 36/40 (90%), Positives = 36/40 (90%) Frame = -2 Query: 533 LWKNASNAGFLRXLAFCWPFAHMFFXALSPDSVDNXITAF 414 LWKNASNA FLR LAFCWPFAHMFF ALSPDSVDN ITAF Sbjct: 21 LWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 83.0 bits (196), Expect = 3e-16 Identities = 36/40 (90%), Positives = 36/40 (90%) Frame = -2 Query: 533 LWKNASNAGFLRXLAFCWPFAHMFFXALSPDSVDNXITAF 414 LWKNASNA FLR LAFCWPFAHMFF ALSPDSVDN ITAF Sbjct: 21 LWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 83.0 bits (196), Expect = 3e-16 Identities = 36/40 (90%), Positives = 36/40 (90%) Frame = -2 Query: 533 LWKNASNAGFLRXLAFCWPFAHMFFXALSPDSVDNXITAF 414 LWKNASNA FLR LAFCWPFAHMFF ALSPDSVDN ITAF Sbjct: 21 LWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_53281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 83.0 bits (196), Expect = 3e-16 Identities = 36/40 (90%), Positives = 36/40 (90%) Frame = -2 Query: 533 LWKNASNAGFLRXLAFCWPFAHMFFXALSPDSVDNXITAF 414 LWKNASNA FLR LAFCWPFAHMFF ALSPDSVDN ITAF Sbjct: 21 LWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_39971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 478 Score = 83.0 bits (196), Expect = 3e-16 Identities = 36/40 (90%), Positives = 36/40 (90%) Frame = -2 Query: 533 LWKNASNAGFLRXLAFCWPFAHMFFXALSPDSVDNXITAF 414 LWKNASNA FLR LAFCWPFAHMFF ALSPDSVDN ITAF Sbjct: 97 LWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 136 >SB_39623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 83.0 bits (196), Expect = 3e-16 Identities = 36/40 (90%), Positives = 36/40 (90%) Frame = -2 Query: 533 LWKNASNAGFLRXLAFCWPFAHMFFXALSPDSVDNXITAF 414 LWKNASNA FLR LAFCWPFAHMFF ALSPDSVDN ITAF Sbjct: 21 LWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_39403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 83.0 bits (196), Expect = 3e-16 Identities = 36/40 (90%), Positives = 36/40 (90%) Frame = -2 Query: 533 LWKNASNAGFLRXLAFCWPFAHMFFXALSPDSVDNXITAF 414 LWKNASNA FLR LAFCWPFAHMFF ALSPDSVDN ITAF Sbjct: 21 LWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_35631| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 83.0 bits (196), Expect = 3e-16 Identities = 36/40 (90%), Positives = 36/40 (90%) Frame = -2 Query: 533 LWKNASNAGFLRXLAFCWPFAHMFFXALSPDSVDNXITAF 414 LWKNASNA FLR LAFCWPFAHMFF ALSPDSVDN ITAF Sbjct: 21 LWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_32025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 83.0 bits (196), Expect = 3e-16 Identities = 36/40 (90%), Positives = 36/40 (90%) Frame = -2 Query: 533 LWKNASNAGFLRXLAFCWPFAHMFFXALSPDSVDNXITAF 414 LWKNASNA FLR LAFCWPFAHMFF ALSPDSVDN ITAF Sbjct: 63 LWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 102 >SB_29245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 83.0 bits (196), Expect = 3e-16 Identities = 36/40 (90%), Positives = 36/40 (90%) Frame = -2 Query: 533 LWKNASNAGFLRXLAFCWPFAHMFFXALSPDSVDNXITAF 414 LWKNASNA FLR LAFCWPFAHMFF ALSPDSVDN ITAF Sbjct: 21 LWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_26817| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 83.0 bits (196), Expect = 3e-16 Identities = 36/40 (90%), Positives = 36/40 (90%) Frame = -2 Query: 533 LWKNASNAGFLRXLAFCWPFAHMFFXALSPDSVDNXITAF 414 LWKNASNA FLR LAFCWPFAHMFF ALSPDSVDN ITAF Sbjct: 21 LWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_22420| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 83.0 bits (196), Expect = 3e-16 Identities = 36/40 (90%), Positives = 36/40 (90%) Frame = -2 Query: 533 LWKNASNAGFLRXLAFCWPFAHMFFXALSPDSVDNXITAF 414 LWKNASNA FLR LAFCWPFAHMFF ALSPDSVDN ITAF Sbjct: 21 LWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_2684| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 83.0 bits (196), Expect = 3e-16 Identities = 36/40 (90%), Positives = 36/40 (90%) Frame = -2 Query: 533 LWKNASNAGFLRXLAFCWPFAHMFFXALSPDSVDNXITAF 414 LWKNASNA FLR LAFCWPFAHMFF ALSPDSVDN ITAF Sbjct: 21 LWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) Length = 229 Score = 82.6 bits (195), Expect = 4e-16 Identities = 51/94 (54%), Positives = 57/94 (60%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLTQRR*XGYPQNQGITQXRTCEQKASKRPXTVKSPRC 517 G + LPRSLTR ARSF CGER LT N G + ++ V+ PR Sbjct: 101 GYIPLPRSLTRYARSFDCGERKWLT---------NGGGDFLEDARKILNRE---VRGPRQ 148 Query: 518 WRFSIGSAPLTSIXKIDAQVRGGETRQXYKDTRR 619 RFSIGSAPLTSI K DAQ+ GGETRQ YKDTRR Sbjct: 149 SRFSIGSAPLTSITKSDAQISGGETRQDYKDTRR 182 >SB_29741| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 45 Score = 81.8 bits (193), Expect = 6e-16 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = -2 Query: 533 LWKNASNAGFLRXLAFCWPFAHMFFXALSPDSVDNXITAF 414 LWKNASNA FLR LAFCWPFAHMF+ ALSPDSVDN ITAF Sbjct: 5 LWKNASNAAFLRFLAFCWPFAHMFYPALSPDSVDNRITAF 44 >SB_28260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 77.0 bits (181), Expect = 2e-14 Identities = 34/38 (89%), Positives = 34/38 (89%) Frame = -2 Query: 527 KNASNAGFLRXLAFCWPFAHMFFXALSPDSVDNXITAF 414 KNASNA FLR LAFCWPFAHMFF ALSPDSVDN ITAF Sbjct: 23 KNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_46297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 76.2 bits (179), Expect = 3e-14 Identities = 34/40 (85%), Positives = 34/40 (85%) Frame = -2 Query: 533 LWKNASNAGFLRXLAFCWPFAHMFFXALSPDSVDNXITAF 414 LWKNASNA FLR LAF WPFAHMFF ALSPD VDN ITAF Sbjct: 21 LWKNASNAAFLRFLAFGWPFAHMFFRALSPDCVDNRITAF 60 >SB_52189| Best HMM Match : DUF454 (HMM E-Value=5.7) Length = 203 Score = 74.9 bits (176), Expect = 7e-14 Identities = 36/45 (80%), Positives = 37/45 (82%) Frame = +2 Query: 287 SALMNRPNAREEAVWVLGALXLPRSLTRCARSFGCGERYQLTQRR 421 S + NAR EAV VLGAL LPRSLTRCARSFGCGERYQLTQRR Sbjct: 99 SCINESANARGEAVCVLGALPLPRSLTRCARSFGCGERYQLTQRR 143 >SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 74.9 bits (176), Expect = 7e-14 Identities = 36/45 (80%), Positives = 37/45 (82%) Frame = +2 Query: 287 SALMNRPNAREEAVWVLGALXLPRSLTRCARSFGCGERYQLTQRR 421 S + NAR EAV VLGAL LPRSLTRCARSFGCGERYQLTQRR Sbjct: 463 SCINESANARGEAVCVLGALPLPRSLTRCARSFGCGERYQLTQRR 507 >SB_6221| Best HMM Match : DUF1289 (HMM E-Value=6) Length = 77 Score = 73.7 bits (173), Expect = 2e-13 Identities = 33/40 (82%), Positives = 33/40 (82%) Frame = -2 Query: 533 LWKNASNAGFLRXLAFCWPFAHMFFXALSPDSVDNXITAF 414 LWKNASNA FLR LAFCWPF HMF ALSPDSVD ITAF Sbjct: 5 LWKNASNAAFLRFLAFCWPFDHMFSPALSPDSVDICITAF 44 >SB_33488| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 71.3 bits (167), Expect = 9e-13 Identities = 46/97 (47%), Positives = 54/97 (55%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLTQRR*XGYPQNQGITQXRTCEQKASKRPXTVKSPRC 517 G + LPRSLTR ARSF CGER LT + + T ++A+ +P Sbjct: 64 GYIPLPRSLTRYARSFDCGERKWLTNGAEISWKMPG---RYLTGSERAAAKP-------- 112 Query: 518 WRFSIGSAPLTSIXKIDAQVRGGETRQXYKDTRRFPL 628 F PLTSI K DAQ+ GGETRQ YKDTRRFPL Sbjct: 113 --FFHRLRPLTSITKSDAQISGGETRQDYKDTRRFPL 147 >SB_25122| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 65.3 bits (152), Expect = 6e-11 Identities = 32/50 (64%), Positives = 36/50 (72%) Frame = -3 Query: 658 RNRRAXEGGFQGETPGIFIXLSGFATSDLSVDFXDARQGGGAYGKTPATR 509 + + + G QGET GIFI LSGFAT+DLSV F DA QGGGAYGKT R Sbjct: 9 QEQESARGSRQGETLGIFIVLSGFATTDLSVRFRDACQGGGAYGKTALPR 58 >SB_10421| Best HMM Match : Guanylate_cyc (HMM E-Value=0) Length = 1485 Score = 48.8 bits (111), Expect = 5e-06 Identities = 24/34 (70%), Positives = 25/34 (73%) Frame = -3 Query: 610 IFIXLSGFATSDLSVDFXDARQGGGAYGKTPATR 509 I LSGFAT+DLSV F DA QGGGAYGKT R Sbjct: 1183 IHTVLSGFATTDLSVRFRDACQGGGAYGKTALPR 1216 >SB_12752| Best HMM Match : Borrelia_orfA (HMM E-Value=0.15) Length = 1774 Score = 48.4 bits (110), Expect = 7e-06 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = -3 Query: 598 LSGFATSDLSVDFXDARQGGGAYGKTPATR 509 LSGFAT+DLSV F DA QGGGAYGKT R Sbjct: 352 LSGFATTDLSVRFRDACQGGGAYGKTALPR 381 >SB_8415| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 194 Score = 48.4 bits (110), Expect = 7e-06 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = -3 Query: 598 LSGFATSDLSVDFXDARQGGGAYGKTPATR 509 LSGFAT+DLSV F DA QGGGAYGKT R Sbjct: 2 LSGFATTDLSVRFRDACQGGGAYGKTALPR 31 >SB_48334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 47.6 bits (108), Expect = 1e-05 Identities = 22/26 (84%), Positives = 23/26 (88%) Frame = -3 Query: 598 LSGFATSDLSVDFXDARQGGGAYGKT 521 LSGFAT+DLSV F DA QGGGAYGKT Sbjct: 2 LSGFATTDLSVRFRDACQGGGAYGKT 27 >SB_55059| Best HMM Match : Orn_Arg_deC_N (HMM E-Value=0) Length = 635 Score = 45.2 bits (102), Expect = 7e-05 Identities = 22/30 (73%), Positives = 22/30 (73%) Frame = -3 Query: 598 LSGFATSDLSVDFXDARQGGGAYGKTPATR 509 LSGFA DLSV F DA QGGGAYGKT R Sbjct: 120 LSGFAPPDLSVRFRDACQGGGAYGKTALPR 149 >SB_56553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 426 Score = 41.1 bits (92), Expect = 0.001 Identities = 24/51 (47%), Positives = 24/51 (47%) Frame = +1 Query: 316 GRGGLGIGXXXXXXXXXXXXXXXXXXXXXXXHSKAVIXLSTESGDNAXKNM 468 G GGL IG HSKAVI LSTESGDNA KNM Sbjct: 51 GPGGLRIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNM 101 >SB_56924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/27 (70%), Positives = 20/27 (74%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLTQR 418 G + LPRSLTR ARSF CGER LT R Sbjct: 78 GYIPLPRSLTRYARSFDCGERKWLTNR 104 >SB_22764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 39.9 bits (89), Expect = 0.003 Identities = 28/61 (45%), Positives = 28/61 (45%) Frame = +1 Query: 322 GGLGIGXXXXXXXXXXXXXXXXXXXXXXXHSKAVIXLSTESGDNAXKNM*AKGQQKAXNR 501 GGL IG HSKAVI LSTESGDNA KNM G KA R Sbjct: 7 GGLRIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNMRLYG--KAIIR 64 Query: 502 K 504 K Sbjct: 65 K 65 >SB_13469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2429 Score = 39.9 bits (89), Expect = 0.003 Identities = 23/50 (46%), Positives = 24/50 (48%) Frame = +1 Query: 319 RGGLGIGXXXXXXXXXXXXXXXXXXXXXXXHSKAVIXLSTESGDNAXKNM 468 RGGL IG HSKAVI LSTESGDNA KN+ Sbjct: 262 RGGLRIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNI 311 >SB_23824| Best HMM Match : RRM_1 (HMM E-Value=1.9e-19) Length = 623 Score = 39.5 bits (88), Expect = 0.003 Identities = 23/49 (46%), Positives = 23/49 (46%) Frame = +1 Query: 322 GGLGIGXXXXXXXXXXXXXXXXXXXXXXXHSKAVIXLSTESGDNAXKNM 468 GGL IG HSKAVI LSTESGDNA KNM Sbjct: 575 GGLRIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNM 623 >SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 39.5 bits (88), Expect = 0.003 Identities = 23/49 (46%), Positives = 23/49 (46%) Frame = +1 Query: 322 GGLGIGXXXXXXXXXXXXXXXXXXXXXXXHSKAVIXLSTESGDNAXKNM 468 GGL IG HSKAVI LSTESGDNA KNM Sbjct: 2 GGLRIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNM 50 >SB_59116| Best HMM Match : TPR_1 (HMM E-Value=6.7e-15) Length = 884 Score = 39.5 bits (88), Expect = 0.003 Identities = 23/51 (45%), Positives = 24/51 (47%) Frame = +1 Query: 316 GRGGLGIGXXXXXXXXXXXXXXXXXXXXXXXHSKAVIXLSTESGDNAXKNM 468 G GGL IG HSKAVI LSTESGDNA KN+ Sbjct: 34 GGGGLRIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNI 84 >SB_49132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 39.5 bits (88), Expect = 0.003 Identities = 23/49 (46%), Positives = 23/49 (46%) Frame = +1 Query: 322 GGLGIGXXXXXXXXXXXXXXXXXXXXXXXHSKAVIXLSTESGDNAXKNM 468 GGL IG HSKAVI LSTESGDNA KNM Sbjct: 140 GGLRIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNM 188 >SB_1272| Best HMM Match : Ras (HMM E-Value=8.9e-08) Length = 492 Score = 39.1 bits (87), Expect = 0.004 Identities = 27/75 (36%), Positives = 32/75 (42%) Frame = +1 Query: 322 GGLGIGXXXXXXXXXXXXXXXXXXXXXXXHSKAVIXLSTESGDNAXKNM*AKGQQKAXNR 501 GGL IG HSKAVI LSTESGDNA KN+ + Q + ++ Sbjct: 309 GGLRIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNISCEIQLFSVHQ 368 Query: 502 KKPALLAFFHRLRPP 546 K L PP Sbjct: 369 KSVTKLDTIVTSTPP 383 >SB_59645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 101 GYIPLPRSLTRYARSFDCGERKWLT 125 >SB_59194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 81 GYIPLPRSLTRYARSFDCGERKWLT 105 >SB_58676| Best HMM Match : FUN14 (HMM E-Value=0.16) Length = 217 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 176 GYIPLPRSLTRYARSFDCGERKWLT 200 >SB_58639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 81 GYIPLPRSLTRYARSFDCGERKWLT 105 >SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 101 GYIPLPRSLTRYARSFDCGERKWLT 125 >SB_58410| Best HMM Match : Umbravirus_LDM (HMM E-Value=5.8) Length = 341 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 300 GYIPLPRSLTRYARSFDCGERKWLT 324 >SB_57920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 64 GYIPLPRSLTRYARSFDCGERKWLT 88 >SB_57210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 138 GYIPLPRSLTRYARSFDCGERKWLT 162 >SB_56445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 125 GYIPLPRSLTRYARSFDCGERKWLT 149 >SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 150 GYIPLPRSLTRYARSFDCGERKWLT 174 >SB_55179| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 81 GYIPLPRSLTRYARSFDCGERKWLT 105 >SB_55096| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 64 GYIPLPRSLTRYARSFDCGERKWLT 88 >SB_54894| Best HMM Match : RuvB_C (HMM E-Value=2.3) Length = 148 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 107 GYIPLPRSLTRYARSFDCGERKWLT 131 >SB_53915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 137 GYIPLPRSLTRYARSFDCGERKWLT 161 >SB_53615| Best HMM Match : GETHR (HMM E-Value=5.3e-09) Length = 653 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 255 GYIPLPRSLTRYARSFDCGERKWLT 279 >SB_53012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 97 GYIPLPRSLTRYARSFDCGERKWLT 121 >SB_52037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 96 GYIPLPRSLTRYARSFDCGERKWLT 120 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 397 GYIPLPRSLTRYARSFDCGERKWLT 421 >SB_51499| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 81 GYIPLPRSLTRYARSFDCGERKWLT 105 >SB_50666| Best HMM Match : ig (HMM E-Value=2.8e-20) Length = 293 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 252 GYIPLPRSLTRYARSFDCGERKWLT 276 >SB_50584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 152 GYIPLPRSLTRYARSFDCGERKWLT 176 >SB_50510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 138 GYIPLPRSLTRYARSFDCGERKWLT 162 >SB_50269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 940 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 615 GYIPLPRSLTRYARSFDCGERKWLT 639 >SB_50037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 64 GYIPLPRSLTRYARSFDCGERKWLT 88 >SB_49291| Best HMM Match : Herpes_UL69 (HMM E-Value=4.5) Length = 491 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 371 GYIPLPRSLTRYARSFDCGERKWLT 395 >SB_49138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 81 GYIPLPRSLTRYARSFDCGERKWLT 105 >SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 101 GYIPLPRSLTRYARSFDCGERKWLT 125 >SB_48746| Best HMM Match : fn3 (HMM E-Value=7.2) Length = 255 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 214 GYIPLPRSLTRYARSFDCGERKWLT 238 >SB_48519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 64 GYIPLPRSLTRYARSFDCGERKWLT 88 >SB_47856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 172 GYIPLPRSLTRYARSFDCGERKWLT 196 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 136 GYIPLPRSLTRYARSFDCGERKWLT 160 >SB_47451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 98 GYIPLPRSLTRYARSFDCGERKWLT 122 >SB_47049| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.69) Length = 178 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 137 GYIPLPRSLTRYARSFDCGERKWLT 161 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 183 GYIPLPRSLTRYARSFDCGERKWLT 207 >SB_45327| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 106 GYIPLPRSLTRYARSFDCGERKWLT 130 >SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 141 GYIPLPRSLTRYARSFDCGERKWLT 165 >SB_44738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 81 GYIPLPRSLTRYARSFDCGERKWLT 105 >SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 157 GYIPLPRSLTRYARSFDCGERKWLT 181 >SB_42360| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 81 GYIPLPRSLTRYARSFDCGERKWLT 105 >SB_42151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 81 GYIPLPRSLTRYARSFDCGERKWLT 105 >SB_42061| Best HMM Match : CcoS (HMM E-Value=1.5) Length = 346 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 81 GYIPLPRSLTRYARSFDCGERKWLT 105 >SB_41957| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 67 GYIPLPRSLTRYARSFDCGERKWLT 91 >SB_41059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 117 GYIPLPRSLTRYARSFDCGERKWLT 141 >SB_40873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2496 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 604 GYIPLPRSLTRYARSFDCGERKWLT 628 >SB_40612| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 117 GYIPLPRSLTRYARSFDCGERKWLT 141 >SB_40524| Best HMM Match : Ribosomal_S18 (HMM E-Value=2) Length = 216 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 175 GYIPLPRSLTRYARSFDCGERKWLT 199 >SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 100 GYIPLPRSLTRYARSFDCGERKWLT 124 >SB_39337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 64 GYIPLPRSLTRYARSFDCGERKWLT 88 >SB_39248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 64 GYIPLPRSLTRYARSFDCGERKWLT 88 >SB_38896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 81 GYIPLPRSLTRYARSFDCGERKWLT 105 >SB_38748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 121 GYIPLPRSLTRYARSFDCGERKWLT 145 >SB_38234| Best HMM Match : RuvB_C (HMM E-Value=7) Length = 184 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 143 GYIPLPRSLTRYARSFDCGERKWLT 167 >SB_38187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 120 GYIPLPRSLTRYARSFDCGERKWLT 144 >SB_36515| Best HMM Match : UPF0126 (HMM E-Value=0.73) Length = 150 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 109 GYIPLPRSLTRYARSFDCGERKWLT 133 >SB_36183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 81 GYIPLPRSLTRYARSFDCGERKWLT 105 >SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 136 GYIPLPRSLTRYARSFDCGERKWLT 160 >SB_35069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 134 GYIPLPRSLTRYARSFDCGERKWLT 158 >SB_34721| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 103 GYIPLPRSLTRYARSFDCGERKWLT 127 >SB_34207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 282 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 241 GYIPLPRSLTRYARSFDCGERKWLT 265 >SB_34127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 64 GYIPLPRSLTRYARSFDCGERKWLT 88 >SB_34032| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-22) Length = 673 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 632 GYIPLPRSLTRYARSFDCGERKWLT 656 >SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) Length = 841 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 354 GYIPLPRSLTRYARSFDCGERKWLT 378 >SB_33167| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 334 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 101 GYIPLPRSLTRYARSFDCGERKWLT 125 >SB_33062| Best HMM Match : DUF485 (HMM E-Value=7.5) Length = 168 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 127 GYIPLPRSLTRYARSFDCGERKWLT 151 >SB_32555| Best HMM Match : RVT_1 (HMM E-Value=2e-35) Length = 895 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 858 GYIPLPRSLTRYARSFDCGERKWLT 882 >SB_32080| Best HMM Match : Plasmid_stabil (HMM E-Value=5.7) Length = 284 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 243 GYIPLPRSLTRYARSFDCGERKWLT 267 >SB_31947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 142 GYIPLPRSLTRYARSFDCGERKWLT 166 >SB_31774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 584 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 543 GYIPLPRSLTRYARSFDCGERKWLT 567 >SB_31098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 436 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 81 GYIPLPRSLTRYARSFDCGERKWLT 105 >SB_31001| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 88 GYIPLPRSLTRYARSFDCGERKWLT 112 >SB_30603| Best HMM Match : PKD_channel (HMM E-Value=1.2e-15) Length = 1029 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 988 GYIPLPRSLTRYARSFDCGERKWLT 1012 >SB_30119| Best HMM Match : VWC (HMM E-Value=2.1) Length = 155 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 114 GYIPLPRSLTRYARSFDCGERKWLT 138 >SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 156 GYIPLPRSLTRYARSFDCGERKWLT 180 >SB_29430| Best HMM Match : AhpC-TSA (HMM E-Value=0.00012) Length = 704 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 493 GYIPLPRSLTRYARSFDCGERKWLT 517 >SB_29254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 81 GYIPLPRSLTRYARSFDCGERKWLT 105 >SB_29238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 97 GYIPLPRSLTRYARSFDCGERKWLT 121 >SB_27679| Best HMM Match : zf-MYND (HMM E-Value=0.00039) Length = 167 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 126 GYIPLPRSLTRYARSFDCGERKWLT 150 >SB_26979| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=0.017) Length = 453 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 289 GYIPLPRSLTRYARSFDCGERKWLT 313 >SB_26811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 64 GYIPLPRSLTRYARSFDCGERKWLT 88 >SB_25376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 34 Score = 38.3 bits (85), Expect = 0.008 Identities = 21/33 (63%), Positives = 21/33 (63%) Frame = -1 Query: 777 PSLERTTYTELRYLQREL*ESATLSRKGERXTG 679 PSLERTTYTELRY E A KGER TG Sbjct: 1 PSLERTTYTELRYYSVSY-EKAPRFPKGERRTG 32 Score = 32.7 bits (71), Expect = 0.39 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = -2 Query: 737 YSVSYEKAPRFPEREK 690 YSVSYEKAPRFP+ E+ Sbjct: 14 YSVSYEKAPRFPKGER 29 >SB_24858| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 64 GYIPLPRSLTRYARSFDCGERKWLT 88 >SB_24766| Best HMM Match : Plasmid_stabil (HMM E-Value=7.3) Length = 149 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 108 GYIPLPRSLTRYARSFDCGERKWLT 132 >SB_24481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 81 GYIPLPRSLTRYARSFDCGERKWLT 105 >SB_24446| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 81 GYIPLPRSLTRYARSFDCGERKWLT 105 >SB_23906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 78 GYIPLPRSLTRYARSFDCGERKWLT 102 >SB_23492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 239 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 198 GYIPLPRSLTRYARSFDCGERKWLT 222 >SB_23266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 283 GYIPLPRSLTRYARSFDCGERKWLT 307 >SB_23148| Best HMM Match : DUF1491 (HMM E-Value=9.3) Length = 150 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 109 GYIPLPRSLTRYARSFDCGERKWLT 133 >SB_21952| Best HMM Match : Pertussis_S2S3 (HMM E-Value=3.2) Length = 198 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 157 GYIPLPRSLTRYARSFDCGERKWLT 181 >SB_21736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 117 GYIPLPRSLTRYARSFDCGERKWLT 141 >SB_20088| Best HMM Match : OAD_gamma (HMM E-Value=3) Length = 200 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 159 GYIPLPRSLTRYARSFDCGERKWLT 183 >SB_19974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 64 GYIPLPRSLTRYARSFDCGERKWLT 88 >SB_19756| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 127 GYIPLPRSLTRYARSFDCGERKWLT 151 >SB_19194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 81 GYIPLPRSLTRYARSFDCGERKWLT 105 >SB_18781| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 129 GYIPLPRSLTRYARSFDCGERKWLT 153 >SB_18659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 81 GYIPLPRSLTRYARSFDCGERKWLT 105 >SB_17152| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 96 GYIPLPRSLTRYARSFDCGERKWLT 120 >SB_16892| Best HMM Match : TIL (HMM E-Value=4.4) Length = 177 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 136 GYIPLPRSLTRYARSFDCGERKWLT 160 >SB_16821| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 105 GYIPLPRSLTRYARSFDCGERKWLT 129 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 999 GYIPLPRSLTRYARSFDCGERKWLT 1023 >SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 146 GYIPLPRSLTRYARSFDCGERKWLT 170 >SB_16131| Best HMM Match : RhoGEF (HMM E-Value=2e-05) Length = 520 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 479 GYIPLPRSLTRYARSFDCGERKWLT 503 >SB_15016| Best HMM Match : Peptidase_C9 (HMM E-Value=7.2) Length = 202 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 161 GYIPLPRSLTRYARSFDCGERKWLT 185 >SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) Length = 568 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 527 GYIPLPRSLTRYARSFDCGERKWLT 551 >SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 134 GYIPLPRSLTRYARSFDCGERKWLT 158 >SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) Length = 631 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 525 GYIPLPRSLTRYARSFDCGERKWLT 549 >SB_12755| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 147 GYIPLPRSLTRYARSFDCGERKWLT 171 >SB_12438| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 105 GYIPLPRSLTRYARSFDCGERKWLT 129 >SB_12289| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 105 GYIPLPRSLTRYARSFDCGERKWLT 129 >SB_11969| Best HMM Match : Papilloma_E5 (HMM E-Value=4.6) Length = 190 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 149 GYIPLPRSLTRYARSFDCGERKWLT 173 >SB_11820| Best HMM Match : EGF_2 (HMM E-Value=9.8) Length = 197 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 156 GYIPLPRSLTRYARSFDCGERKWLT 180 >SB_11146| Best HMM Match : K_tetra (HMM E-Value=1.1e-34) Length = 336 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 295 GYIPLPRSLTRYARSFDCGERKWLT 319 >SB_9574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 175 GYIPLPRSLTRYARSFDCGERKWLT 199 >SB_9532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1339 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 1210 GYIPLPRSLTRYARSFDCGERKWLT 1234 >SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 106 GYIPLPRSLTRYARSFDCGERKWLT 130 >SB_9470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 126 GYIPLPRSLTRYARSFDCGERKWLT 150 >SB_8947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 111 GYIPLPRSLTRYARSFDCGERKWLT 135 >SB_8444| Best HMM Match : BRE (HMM E-Value=6.4) Length = 502 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 64 GYIPLPRSLTRYARSFDCGERKWLT 88 >SB_8427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 64 GYIPLPRSLTRYARSFDCGERKWLT 88 >SB_8359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 104 GYIPLPRSLTRYARSFDCGERKWLT 128 >SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 134 GYIPLPRSLTRYARSFDCGERKWLT 158 >SB_7275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 125 GYIPLPRSLTRYARSFDCGERKWLT 149 >SB_7053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 102 GYIPLPRSLTRYARSFDCGERKWLT 126 >SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2670 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 1480 GYIPLPRSLTRYARSFDCGERKWLT 1504 >SB_6150| Best HMM Match : GAT (HMM E-Value=2.3e-34) Length = 674 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 633 GYIPLPRSLTRYARSFDCGERKWLT 657 >SB_5713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 93 GYIPLPRSLTRYARSFDCGERKWLT 117 >SB_5443| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 371 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 330 GYIPLPRSLTRYARSFDCGERKWLT 354 >SB_5310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 219 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 178 GYIPLPRSLTRYARSFDCGERKWLT 202 >SB_5128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2102 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 542 GYIPLPRSLTRYARSFDCGERKWLT 566 >SB_4813| Best HMM Match : EMP24_GP25L (HMM E-Value=3.9e-13) Length = 348 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 81 GYIPLPRSLTRYARSFDCGERKWLT 105 >SB_4398| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 95 GYIPLPRSLTRYARSFDCGERKWLT 119 >SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) Length = 205 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 164 GYIPLPRSLTRYARSFDCGERKWLT 188 >SB_3825| Best HMM Match : Pheromone (HMM E-Value=3.3) Length = 189 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 148 GYIPLPRSLTRYARSFDCGERKWLT 172 >SB_3784| Best HMM Match : ICAM_N (HMM E-Value=4.1) Length = 142 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 101 GYIPLPRSLTRYARSFDCGERKWLT 125 >SB_3664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 148 GYIPLPRSLTRYARSFDCGERKWLT 172 >SB_3135| Best HMM Match : KorB_C (HMM E-Value=2.8) Length = 227 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 186 GYIPLPRSLTRYARSFDCGERKWLT 210 >SB_2945| Best HMM Match : NADH_dehy_S2_C (HMM E-Value=4.4) Length = 157 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 116 GYIPLPRSLTRYARSFDCGERKWLT 140 >SB_2451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 81 GYIPLPRSLTRYARSFDCGERKWLT 105 >SB_2317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 199 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 158 GYIPLPRSLTRYARSFDCGERKWLT 182 >SB_1908| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 97 GYIPLPRSLTRYARSFDCGERKWLT 121 >SB_941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 123 GYIPLPRSLTRYARSFDCGERKWLT 147 >SB_630| Best HMM Match : Pox_F17 (HMM E-Value=2.4) Length = 160 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 119 GYIPLPRSLTRYARSFDCGERKWLT 143 >SB_602| Best HMM Match : TSP_1 (HMM E-Value=1e-27) Length = 590 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 549 GYIPLPRSLTRYARSFDCGERKWLT 573 >SB_215| Best HMM Match : ALG3 (HMM E-Value=0.18) Length = 521 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 444 GYIPLPRSLTRYARSFDCGERKWLT 468 >SB_12| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 81 GYIPLPRSLTRYARSFDCGERKWLT 105 >SB_59622| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 64 GYIPLPRSLTRYARSFDCGERKWLT 88 >SB_59470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 64 GYIPLPRSLTRYARSFDCGERKWLT 88 >SB_59436| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 64 GYIPLPRSLTRYARSFDCGERKWLT 88 >SB_59341| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 64 GYIPLPRSLTRYARSFDCGERKWLT 88 >SB_59321| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 64 GYIPLPRSLTRYARSFDCGERKWLT 88 >SB_59114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 97 GYIPLPRSLTRYARSFDCGERKWLT 121 >SB_58497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 64 GYIPLPRSLTRYARSFDCGERKWLT 88 >SB_58355| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 64 GYIPLPRSLTRYARSFDCGERKWLT 88 >SB_58133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 64 GYIPLPRSLTRYARSFDCGERKWLT 88 >SB_58128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 81 GYIPLPRSLTRYARSFDCGERKWLT 105 >SB_57986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 64 GYIPLPRSLTRYARSFDCGERKWLT 88 >SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 272 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 231 GYIPLPRSLTRYARSFDCGERKWLT 255 >SB_57590| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 64 GYIPLPRSLTRYARSFDCGERKWLT 88 >SB_57559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 116 GYIPLPRSLTRYARSFDCGERKWLT 140 >SB_57358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 64 GYIPLPRSLTRYARSFDCGERKWLT 88 >SB_57221| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 64 GYIPLPRSLTRYARSFDCGERKWLT 88 >SB_56778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 64 GYIPLPRSLTRYARSFDCGERKWLT 88 >SB_56683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 64 GYIPLPRSLTRYARSFDCGERKWLT 88 >SB_56485| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 64 GYIPLPRSLTRYARSFDCGERKWLT 88 >SB_56405| Best HMM Match : Fels1 (HMM E-Value=6.5) Length = 119 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 78 GYIPLPRSLTRYARSFDCGERKWLT 102 >SB_56072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1308 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 99 GYIPLPRSLTRYARSFDCGERKWLT 123 >SB_55971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 64 GYIPLPRSLTRYARSFDCGERKWLT 88 >SB_55894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 64 GYIPLPRSLTRYARSFDCGERKWLT 88 >SB_55772| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 64 GYIPLPRSLTRYARSFDCGERKWLT 88 >SB_55573| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 64 GYIPLPRSLTRYARSFDCGERKWLT 88 >SB_55215| Best HMM Match : Peptidase_A16_N (HMM E-Value=0.0003) Length = 458 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 64 GYIPLPRSLTRYARSFDCGERKWLT 88 >SB_55103| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 64 GYIPLPRSLTRYARSFDCGERKWLT 88 >SB_55047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 64 GYIPLPRSLTRYARSFDCGERKWLT 88 >SB_54903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 64 GYIPLPRSLTRYARSFDCGERKWLT 88 >SB_54851| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 64 GYIPLPRSLTRYARSFDCGERKWLT 88 >SB_54599| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 98 GYIPLPRSLTRYARSFDCGERKWLT 122 >SB_54482| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 64 GYIPLPRSLTRYARSFDCGERKWLT 88 >SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 141 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 101 GYIPLPRSLTRYARSFDCGERKWLT 125 >SB_54325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 682 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 641 GYIPLPRSLTRYARSFDCGERKWLT 665 >SB_53936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 95 GYIPLPRSLTRYARSFDCGERKWLT 119 >SB_53836| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 64 GYIPLPRSLTRYARSFDCGERKWLT 88 >SB_53698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 81 GYIPLPRSLTRYARSFDCGERKWLT 105 >SB_53493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +2 Query: 338 GALXLPRSLTRCARSFGCGERYQLT 412 G + LPRSLTR ARSF CGER LT Sbjct: 64 GYIPLPRSLTRYARSFDCGERKWLT 88 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,695,250 Number of Sequences: 59808 Number of extensions: 415820 Number of successful extensions: 2466 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 1822 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2461 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2395401800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -