BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_O23 (888 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_6257| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.8 SB_23320| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.8 >SB_6257| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1218 Score = 28.3 bits (60), Expect = 8.8 Identities = 18/45 (40%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = -1 Query: 363 HAYDPIGASVYSKSPMVRAETFSSPND-TSSFVAYHKVRVSCSSL 232 ++YD I S YS M R +TF S ND T+ V Y + C S+ Sbjct: 716 YSYDKITFSPYSDESM-RIKTFVSNNDGTTEVVKYLAEPIQCRSV 759 >SB_23320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1136 Score = 28.3 bits (60), Expect = 8.8 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -1 Query: 396 GDPCVFFGLVQHAYDPIGAS 337 G PC+ G V H Y P+ AS Sbjct: 165 GFPCIISGTVYHTYHPVSAS 184 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,886,862 Number of Sequences: 59808 Number of extensions: 511239 Number of successful extensions: 1383 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1257 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1381 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2538363813 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -