BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_O22 (887 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 27 0.17 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 27 0.30 DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. 24 1.6 DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholi... 23 3.7 DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholi... 23 3.7 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 23 4.9 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 27.5 bits (58), Expect = 0.17 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = +2 Query: 131 SRYLLEVTCKALQILGQTYKCQIQSDRSTPALYEPYQPA 247 S Y + T Q QT + Q+ DR++P Y Y PA Sbjct: 394 SLYPMATTSPQSQSTIQTLRPQVSPDRTSPMEYRLYNPA 432 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 26.6 bits (56), Expect = 0.30 Identities = 17/49 (34%), Positives = 26/49 (53%) Frame = +2 Query: 362 DDGGCSSCYRKSSCTHFGCWRRNSYF*SAGSSCSDWQEDSTGYKVSENA 508 +DGGCSS S+ + +++N Y SS S + S YK SE++ Sbjct: 924 NDGGCSSLVDVSTPVNKKVYKQNDYIVDESSSSSFY--SSFLYKSSESS 970 >DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. Length = 495 Score = 24.2 bits (50), Expect = 1.6 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -2 Query: 361 FGILYSLTSFVTVPTTTA 308 FG +Y L ++ VPTTTA Sbjct: 367 FGSIYFLGNYSLVPTTTA 384 >DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 23.0 bits (47), Expect = 3.7 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = -2 Query: 376 AATVIFGILYSLTSFVTVPTTTAIKPS 296 ++ VIFG+L+ L SF+ T T ++P+ Sbjct: 14 SSCVIFGVLFVLFSFLR--TRTKLQPT 38 >DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 23.0 bits (47), Expect = 3.7 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = -2 Query: 376 AATVIFGILYSLTSFVTVPTTTAIKPS 296 ++ VIFG+L+ L SF+ T T ++P+ Sbjct: 14 SSCVIFGVLFVLFSFLR--TRTKLQPT 38 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 22.6 bits (46), Expect = 4.9 Identities = 8/22 (36%), Positives = 16/22 (72%) Frame = -2 Query: 271 AKRDTEIGGRLIRLIKSRRRTI 206 AK+ T IGG+ + ++KS +++ Sbjct: 889 AKKATNIGGKPVAVVKSSAQSL 910 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 197,235 Number of Sequences: 438 Number of extensions: 3785 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 28662543 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -