BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_O21 (885 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglu... 25 1.0 AJ829922-1|CAH25640.1| 193|Tribolium castaneum twist bHLH trans... 22 5.6 U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 21 9.7 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 9.7 >EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglucosaminidase NAG2 protein. Length = 593 Score = 24.6 bits (51), Expect = 1.0 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = -1 Query: 291 KSCASFDLVSELNCCSKVLWNSLGVVFDVLEEVGSVASH 175 KS A+FD V+ + +LW S DV+E+ S A + Sbjct: 418 KSLAAFDFVARNSDTPIILWTSHLTQADVIEKYLSKARY 456 >AJ829922-1|CAH25640.1| 193|Tribolium castaneum twist bHLH transcription factor protein. Length = 193 Score = 22.2 bits (45), Expect = 5.6 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +1 Query: 178 RRDAPDFFKDIEH 216 RR AP F+DI+H Sbjct: 84 RRKAPQSFEDIQH 96 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 21.4 bits (43), Expect = 9.7 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -1 Query: 282 ASFDLVSELNCCSKVLWNSL 223 A D SE++C S+ +W+ L Sbjct: 102 ALLDTGSEVSCISEEVWSKL 121 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.4 bits (43), Expect = 9.7 Identities = 12/37 (32%), Positives = 16/37 (43%) Frame = -2 Query: 233 GTPLVWCSMSLKKSGASRRTIAPLGQSDAGEENYELG 123 G P+ S SL + + A G +AGEE G Sbjct: 2064 GMPMYGQSFSLADNNQNGLNAATYGGGEAGEETRARG 2100 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 124,584 Number of Sequences: 336 Number of extensions: 1853 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 24513621 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -