BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_O16 (885 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_4268| Best HMM Match : MtrG (HMM E-Value=1.2) 29 3.8 SB_53037| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.7 >SB_4268| Best HMM Match : MtrG (HMM E-Value=1.2) Length = 542 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/37 (35%), Positives = 23/37 (62%) Frame = +2 Query: 368 QETKTFRPSIRGCWLQIWVQFETVGQLAQILGRRXPI 478 Q T PS +G L ++++F+T G+ ++ GRR P+ Sbjct: 321 QHAATASPSTQG--LTVYLRFQTAGRPMELSGRRMPV 355 >SB_53037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 499 Score = 28.3 bits (60), Expect = 8.7 Identities = 19/55 (34%), Positives = 32/55 (58%), Gaps = 2/55 (3%) Frame = +3 Query: 210 CTSSXLKSPPPMPQLDLEEWWG--PPELKQKQDTSIKPFEITFSETMVKELKERI 368 C +S +++P P+P+LD+ + P ELK + S F ++ +VKE KER+ Sbjct: 38 CLNSEVETPLPLPELDVGKKTSSLPSELKSRAFESSSVF---YNPYLVKE-KERL 88 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,018,357 Number of Sequences: 59808 Number of extensions: 481359 Number of successful extensions: 1188 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1126 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1188 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2526446612 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -