BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_O11 (1257 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 29 5.9 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.8 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 29.5 bits (63), Expect = 5.9 Identities = 19/60 (31%), Positives = 21/60 (35%) Frame = -2 Query: 599 PXXPXGGGGXGXXPPPXXXXXFFFFXXXFXXPXKXXXXPPPPXGGGGGXXKNXXPKKFVV 420 P P GG G PPP P PPPP G GG P+K V+ Sbjct: 664 PPPPPGGQAGGAPPPPPPPLPGGAAPPP--PPPIGGGAPPPPPPGFGGFANLVKPRKGVI 721 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 29.1 bits (62), Expect = 7.8 Identities = 16/47 (34%), Positives = 16/47 (34%), Gaps = 2/47 (4%) Frame = +1 Query: 457 PPPPPXGGGGXXXFXXGXXXXXXKKKXXXXXX--GGGXXPXPPPPXG 591 PPPPP G G GGG P PPPP G Sbjct: 933 PPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGG 979 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,554,046 Number of Sequences: 59808 Number of extensions: 194119 Number of successful extensions: 453 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 166 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 318 length of database: 16,821,457 effective HSP length: 84 effective length of database: 11,797,585 effective search space used: 3940393390 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -