BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_N22 (870 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ384991-1|ABD51779.1| 94|Apis mellifera allergen Api m 6 vari... 27 0.30 DQ384990-1|ABD51778.1| 92|Apis mellifera allergen Api m 6 vari... 27 0.30 AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic ac... 23 3.7 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 22 6.4 >DQ384991-1|ABD51779.1| 94|Apis mellifera allergen Api m 6 variant 2 precursor protein. Length = 94 Score = 26.6 bits (56), Expect = 0.30 Identities = 13/43 (30%), Positives = 18/43 (41%) Frame = +1 Query: 232 CVRTCDDPYLTNTACVGALIQTCHCNDGLVFNADRKCVPISDC 360 C R C + + C+ C C G + N + CVP S C Sbjct: 50 CQRFCPN-VVPKPLCIKICAPGCVCRLGYLRNKKKVCVPRSKC 91 >DQ384990-1|ABD51778.1| 92|Apis mellifera allergen Api m 6 variant 1 precursor protein. Length = 92 Score = 26.6 bits (56), Expect = 0.30 Identities = 13/43 (30%), Positives = 18/43 (41%) Frame = +1 Query: 232 CVRTCDDPYLTNTACVGALIQTCHCNDGLVFNADRKCVPISDC 360 C R C + + C+ C C G + N + CVP S C Sbjct: 50 CQRFCPN-VVPKPLCIKICAPGCVCRLGYLRNKKKVCVPRSKC 91 >AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic acetylcholine receptorApisa2 subunit protein. Length = 541 Score = 23.0 bits (47), Expect = 3.7 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = -1 Query: 282 ADASGVSQVRVVAGPHAGGHQSNGHFQGIH 193 A A+ V +V+ P + HQ G G+H Sbjct: 380 AVAAAVQSSSIVSSPDSARHQRIGGCNGLH 409 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 22.2 bits (45), Expect = 6.4 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = -1 Query: 513 LSCLDPNXPSL 481 ++CLDPN P L Sbjct: 593 INCLDPNLPKL 603 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 181,396 Number of Sequences: 438 Number of extensions: 3471 Number of successful extensions: 12 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 28159464 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -