BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_N20 (866 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U40799-6|AAA81484.2| 210|Caenorhabditis elegans Ground-like (gr... 28 7.5 AC090999-2|AAK26145.1| 139|Caenorhabditis elegans Hypothetical ... 28 9.9 >U40799-6|AAA81484.2| 210|Caenorhabditis elegans Ground-like (grd related) protein 4 protein. Length = 210 Score = 28.3 bits (60), Expect = 7.5 Identities = 16/56 (28%), Positives = 16/56 (28%) Frame = +3 Query: 666 PPXAXLPXVLPXXPSPXXTXPXCPXLWXXPCRXXMSPXPXXXLSPXXXXXPPXXPC 833 PP P LP P P CP C P P P P PC Sbjct: 34 PPPMCAPPPLPCPPPPICPPQFCPP--PPMCPPPPPPPPPPMCPPPPPPMPSYSPC 87 >AC090999-2|AAK26145.1| 139|Caenorhabditis elegans Hypothetical protein Y82E9BR.9 protein. Length = 139 Score = 27.9 bits (59), Expect = 9.9 Identities = 12/40 (30%), Positives = 24/40 (60%) Frame = -3 Query: 186 NITVFPPRFFILFRYMFLFLSLRHVQQNNNISVSKTSTRQ 67 N+T+ + I++ +++L SLR V + N I++ T R+ Sbjct: 86 NVTLNTIKSPIIYLFIYLLRSLRDVMKTNYINIKTTKNRR 125 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,143,204 Number of Sequences: 27780 Number of extensions: 191776 Number of successful extensions: 573 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 418 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 543 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2171433726 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -