BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_N13 (879 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31 |Schizo... 26 8.1 SPAC4F10.16c |||P-type ATPase |Schizosaccharomyces pombe|chr 1||... 26 8.1 >SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1224 Score = 25.8 bits (54), Expect = 8.1 Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = +3 Query: 156 APHLLPTARXSLILPKPP-TLMXTAPHLSTTVHLT 257 AP T++ S ILP P T T+P+ +T+ H+T Sbjct: 810 APVQPKTSQASSILPTVPRTTSYTSPYATTSSHIT 844 >SPAC4F10.16c |||P-type ATPase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1367 Score = 25.8 bits (54), Expect = 8.1 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -3 Query: 343 NFLRYXLLPTASTRERGRLEVRSALGTVHVRC 248 NF ++P STR+R + +R G +H+ C Sbjct: 756 NFRVLDIIPFTSTRKRMSVIIRDEDGIIHLIC 787 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,746,452 Number of Sequences: 5004 Number of extensions: 25651 Number of successful extensions: 49 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 47 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 49 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 440481800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -