BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_N11 (876 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014297-4663|AAF57085.1| 1105|Drosophila melanogaster CG12072-P... 29 6.4 AE013599-2987|AAF57490.2| 1625|Drosophila melanogaster CG8908-PA... 29 6.4 AE013599-2986|AAM68403.2| 1665|Drosophila melanogaster CG8908-PB... 29 6.4 U31961-5|AAA84404.1| 424|Drosophila melanogaster protein ( Dros... 29 8.4 AE014297-2268|AAF55361.3| 417|Drosophila melanogaster CG10349-P... 29 8.4 >AE014297-4663|AAF57085.1| 1105|Drosophila melanogaster CG12072-PA protein. Length = 1105 Score = 29.5 bits (63), Expect = 6.4 Identities = 19/54 (35%), Positives = 23/54 (42%), Gaps = 4/54 (7%) Frame = +3 Query: 543 PDEHHKNRRSSQRWRNPTGL*RYQAFPPGSSSCALLFRPCRLPDTC----PPSP 692 P HH ++ SS+ NP G + P G S A P R P C PP P Sbjct: 161 PHSHHTHQPSSRTVGNPGGNGGFSPSPSGFSEVAPPAPPPRNPTACSAATPPPP 214 >AE013599-2987|AAF57490.2| 1625|Drosophila melanogaster CG8908-PA, isoform A protein. Length = 1625 Score = 29.5 bits (63), Expect = 6.4 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +2 Query: 602 IKIPGVSPWKLLVRSPVPTLPLTGYLSAF 688 + + G PW+LL+ VPTLP T ++ F Sbjct: 338 VHLIGCLPWRLLLMGYVPTLPRTIFVCLF 366 >AE013599-2986|AAM68403.2| 1665|Drosophila melanogaster CG8908-PB, isoform B protein. Length = 1665 Score = 29.5 bits (63), Expect = 6.4 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +2 Query: 602 IKIPGVSPWKLLVRSPVPTLPLTGYLSAF 688 + + G PW+LL+ VPTLP T ++ F Sbjct: 338 VHLIGCLPWRLLLMGYVPTLPRTIFVCLF 366 >U31961-5|AAA84404.1| 424|Drosophila melanogaster protein ( Drosophila melanogasterbithorax complex (BX-C), complete sequence. ). Length = 424 Score = 29.1 bits (62), Expect = 8.4 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +1 Query: 298 ESANARGEAVCVLGALPLPRSLTRCARSFGCG 393 ES +VC G LP+P L C + GCG Sbjct: 340 ESYQTTSASVCHSGWLPVPGHLAGCGQRRGCG 371 >AE014297-2268|AAF55361.3| 417|Drosophila melanogaster CG10349-PA protein. Length = 417 Score = 29.1 bits (62), Expect = 8.4 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +1 Query: 298 ESANARGEAVCVLGALPLPRSLTRCARSFGCG 393 ES +VC G LP+P L C + GCG Sbjct: 333 ESYQTTSASVCHSGWLPVPGHLAGCGQRRGCG 364 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 33,459,121 Number of Sequences: 53049 Number of extensions: 701693 Number of successful extensions: 1682 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1582 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1682 length of database: 24,988,368 effective HSP length: 84 effective length of database: 20,532,252 effective search space used: 4250176164 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -