BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_N10 (899 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 23 3.8 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 23 3.8 AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 23 5.0 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 23.0 bits (47), Expect = 3.8 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +2 Query: 62 SAHQVISTAPLVSQRPPLNLHKLTMNFAKIL 154 SA ++ T P PP+NL ++ ++IL Sbjct: 994 SAELIVRTEPQRPAGPPINLEARALSSSEIL 1024 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 23.0 bits (47), Expect = 3.8 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +2 Query: 62 SAHQVISTAPLVSQRPPLNLHKLTMNFAKIL 154 SA ++ T P PP+NL ++ ++IL Sbjct: 990 SAELIVRTEPQRPAGPPINLEARALSSSEIL 1020 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 22.6 bits (46), Expect = 5.0 Identities = 11/28 (39%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Frame = +1 Query: 268 RQSGPGDRGPR-FG*SYRKMIFKTCAIN 348 R GPG +GPR F S+R C ++ Sbjct: 56 RNPGPGSKGPRDFPRSHRFKSLPRCQLS 83 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 163,712 Number of Sequences: 438 Number of extensions: 2619 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 29146299 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -