BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_N08 (866 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ370037-1|ABD18598.1| 121|Anopheles gambiae putative TIL domai... 24 6.9 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 23 9.1 >DQ370037-1|ABD18598.1| 121|Anopheles gambiae putative TIL domain polypeptide protein. Length = 121 Score = 23.8 bits (49), Expect = 6.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = +1 Query: 355 GFNACCGKRT*QECYCRRNDVEGLLFRLICTFRHPRGNV 471 G + C K + C+CR V R I ++R +G++ Sbjct: 83 GDHLACTKHCVEGCFCRNGYVRDKYDRCIPSYRCGKGSL 121 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 23.4 bits (48), Expect = 9.1 Identities = 7/13 (53%), Positives = 12/13 (92%) Frame = +3 Query: 342 KEHRRFQRLLWKT 380 +E R+FQR+LW++ Sbjct: 804 EEDRKFQRILWRS 816 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 745,846 Number of Sequences: 2352 Number of extensions: 13740 Number of successful extensions: 19 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 92613024 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -