BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_N06 (908 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 23 2.9 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 23 3.8 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 6.7 AB201717-1|BAD90662.1| 107|Apis mellifera apime-corazonin prepr... 22 8.9 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 23.4 bits (48), Expect = 2.9 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = +3 Query: 477 DWEKWKFLCLLITKNRFQKIMMYYLMMGLH 566 DW WKF L+ + F + + ++ LH Sbjct: 861 DWRHWKFPNLVEVLDEFPSVRPFAPLLLLH 890 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 23.0 bits (47), Expect = 3.8 Identities = 9/34 (26%), Positives = 15/34 (44%) Frame = +2 Query: 317 FYPLDFTFVCPTELIAFSDKAKDFAGIDCQVIGV 418 F D CP ++D+ + +DC +GV Sbjct: 752 FDACDCEMTCPAGCKCYNDRTWNTNAVDCSGLGV 785 Score = 22.6 bits (46), Expect = 5.1 Identities = 25/82 (30%), Positives = 35/82 (42%), Gaps = 2/82 (2%) Frame = +2 Query: 338 FVCPTELIAFS-DKAKDFAGIDCQVIGVSTDSEFSHLAWINTPRKD-GGLGKMEIPLLAD 511 F+C E F+ DF DC++ + ++ W NT D GLG EIP Sbjct: 735 FLCRYEAHCFALCHCCDFDACDCEMTCPAGCKCYNDRTW-NTNAVDCSGLGVEEIP---- 789 Query: 512 YKKQISKDYDVLLDDGFALRGL 577 ++I D + DG LR L Sbjct: 790 --RRIPMDATEVYLDGNVLREL 809 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.2 bits (45), Expect = 6.7 Identities = 10/36 (27%), Positives = 16/36 (44%) Frame = +2 Query: 659 PPGQGLPVRRQARRGVPGRLEPGHQRRHHQAEPQGQ 766 PP Q L + + +P Q++ Q +PQ Q Sbjct: 809 PPHQQLHHHQSTHPQAQAQAQPQQQQQQQQQQPQQQ 844 >AB201717-1|BAD90662.1| 107|Apis mellifera apime-corazonin preprohormone protein. Length = 107 Score = 21.8 bits (44), Expect = 8.9 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +3 Query: 204 ELLKFRSLLQTSVRQQLSMESSINLNF 284 EL K R LLQ ++ QL LNF Sbjct: 58 ELQKLRLLLQGNINNQLFQTPCELLNF 84 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 229,223 Number of Sequences: 438 Number of extensions: 4797 Number of successful extensions: 11 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 29509116 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -